[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for atum0:AAK88515.1

[Show Plain Result]


## Summary of Sequence Search
    1::210
    1::210     3e-84  72%  210 aa  COBH_PSEDE RecName: Full=Precorrin-8X methylmutase;       
    3::186     2e-50  53%  208 aa  COBH_PSEAE RecName: Full=Precorrin-8X methylmutase;       
    3::183     9e-34  40%  208 aa  COBH_MYCTU RecName: Full=Precorrin-8X methylmutase;       
    3::183     9e-34  40%  208 aa  COBH_MYCBO RecName: Full=Precorrin-8X methylmutase;       
    9::187     2e-22  37%  206 aa  CBIC_METTH RecName: Full=Cobalt-precorrin-8X methylmutase;       
    6::201     1e-17  31%  210 aa  CBIC_METJA RecName: Full=Cobalt-precorrin-8X methylmutase;       
   12::209     2e-17  35%  217 aa  CBIC_SYNY3 RecName: Full=Cobalt-precorrin-8X methylmutase;       
  263::438     3e-13  37%  446 aa  CBIH_ARCFU RecName: Full=Cobalamin biosynthesis protein
    3::203     1e-08  30%  210 aa  CBIC_SALTY RecName: Full=Cobalt-precorrin-8X methylmutase;       
    1::210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTDYDYIRDGNAIYERSFAIIREEADLSAFTEEQADIAIRMIHACGQVEAAGHFRFSPDFVSAARGALLA
COBH_PSEDE      MPEYDYIRDGNAIYERSFAIIRAEADLSRFSEEEADLAVRMVHACGSVEATRQFVFSPDFVSSARAALKA
COBH_PSEAE      ----DYIRDGQAIYRQSFATIRAEANLAGIPADLEKLAVRVIHACGMVDVVDDLRFSPXXXXXXXXXXXX
COBH_MYCTU      ----DYLRDAAEIYRRSFAVIRAEADLARFPADVARVVVRLIHTCGQVDVAEHVAYTDDVVXXXXXXXXX
COBH_MYCBO      ----DYLRDAAEIYRRSFAVIRAEADLARFPADVARVVVRLIHTCGQVDVAEHVAYTDDVVXXXXXXXXX
CBIC_METTH      ---------GYEIARKSREIVRESEDISSLGPAEVAIVERIVHSTADPEYARITEFSQGFVDEALRSLRS
CBIC_METJA      -------KDGLNIANKSREIVRNKIKINEFNEKEMGIIERVVHATADPEYAKLLVFKNNPXXXXXXXXXX
CBIC_SYNY3      ----------------SFAHIDRSVGPHNLSSQEYAIARRVIHSTADFDFLHLLRFAPDLPQAARGSLRH
CBIH_ARCFU      -------KGGMEVARRSEEILR-----SFYPEERGDIIRRCIATTGDVTIKDVIRFVGDTEEGVR-ALRD
CBIC_SALTY      -----YIQQPQTIEANSFTIISDRPDYRFASPLHEAIIKRVIHTTADFDWLDILWFSADALEQLCDALRH


                         .         .         *         .         .         .         .:140
query           GKPVLCDAQMVAHGVTHARLPADNAVICTLRDPRTPELAKNIGNTRSXXXXXXXXXXXXXXXVAIGNAPT
COBH_PSEDE      GAPILCDAEMVAHGVTRARLPAGNEVICTLRDPRTPALAAEIGNTRSAAALKLWSERLAGSVVAIGNAPT
COBH_PSEAE      XXXILCDARMVAEGVTRSRLPAANRVICTLNEADVPALATELGNTRSAVALEHWREHLEGSVVVIGNAPT
COBH_MYCTU      XXPVLCDSSMVAAGITTSRLPADNQIVSLVADPRATELAARRQTTRSAAGVELCAERLPGAVLAIGNAPT
COBH_MYCBO      XXPVLCDSSMVAAGITTSRLPADNQIVSLVADPRATELAARRQTTRSAAGVELCAERLPGAVLAIGNAPT
CBIC_METTH      SGGILTDIEMVRAGISHPSR-------CYIREPAVRELAEKRDITRAAASMEYAASQGFRGIVVIGNAPT
CBIC_METJA      XXXXXVDVNMIKAGIRY------NKVHCFINHPDVYEVAKKEGITRAVASMRLAKDLIDDGIVVIGNSPT
CBIC_SYNY3      GQTIVVDVNMVKQGIQGLVQRTFNNPIQTAIDFAT---IADPGKTRTETGMDRCIAQFPEAIYVIGNAPT
CBIH_ARCFU      GCRIIADVHMVRAGLRRDAIVAVD--FARGDDTRTASGIRNLAEM------------IEGSLVAIGNSPS
CBIC_SALTY      PCIIYTDTTMALSGINKRLLATFGGECCYISDPRVVRAAQTQGITRSMAAVDIAIAEEEKNKLFVGNAPT


                         +         .         .         .         .         *         .:210
query           ALFYLLEMLEKGGPRPAAIIGMPVGFVGAAESKDALEASALGIPYAIVKGRLGGSAMTAAAINAVARAGL
COBH_PSEDE      ALFFLLEMLRDGAPKPAAILGMPVGFVGAAESKDALAENSYGVPFAIVRGRLGGSAMTAAALNSLARPGL
COBH_PSEAE      ALFYLLEMLDAGAPKPALILGFPVGFVGAAESKEMLAADSRGVPYVIV----------------------
COBH_MYCTU      ALFRLLELVDEXXXXXXXXXXXXXXXXXSAQAKEELIERPRGMSY-------------------------
COBH_MYCBO      ALFRLLELVDEXXXXXXXXXXXXXXXXXSAQAKEELIERPRGMSY-------------------------
CBIC_METTH      ALMKVIELTLEGLMDARAVIGVPVGFVGAAESKEALRGTE--IPHMITRGPKGGT---------------
CBIC_METJA      ALFEVIRLVKEENIKPKLIVGVPVGFVQASESKEALR--EVNVPSISTIGPKGGTPVAVAIINGI-----
CBIC_SYNY3      ALLTLCQAIAAGKAKPALVIGVPVGFIGVLEAKKAL--SLLPCPQIRVEGNKGGSPVAAGIVNAL-----
CBIH_ARCFU      AAFALCEVAEKHPPR--FIVATPVGFVNAAESKEMVR--KLPVPSVTTEGPRGGSGICAAIVNCL-----
CBIC_SALTY      ALFRLLE----HNXXXXXXXXXXXXXXXAAESKEALTHS--HFPAVAALGRKGGSNVAAAIVNAL-----