[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK85845.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3buzA.bssp"
#ERROR : Can't open dsspfile "2bzrF.bssp"
#ERROR : Can't open dsspfile "2bzrC.bssp"
#ERROR : Can't open dsspfile "2bzrB.bssp"
#ERROR : Can't open dsspfile "2bzrD.bssp"
#ERROR : Can't open dsspfile "2bzrA.bssp"
#ERROR : Can't open dsspfile "2a7sA.bssp"
#ERROR : Can't open dsspfile "3bfjA.bssp"
#ERROR : Can't open dsspfile "2dubE.bssp"
#ERROR : Can't open dsspfile "2dubA.bssp"
#ERROR : Can't open dsspfile "2a7kE.bssp"
#ERROR : Can't open dsspfile "2dubD.bssp"
#ERROR : Can't open dsspfile "1dl6A.bssp"
#ERROR : Can't open dsspfile "2a7kC.bssp"
#ERROR : Can't open dsspfile "3bppA.bssp"
#ERROR : Can't open dsspfile "1ef8A.bssp"
#ERROR : Can't open dsspfile "2a7kG.bssp"
#ERROR : Can't open dsspfile "1bnkA.bssp"
#ERROR : Can't open dsspfile "2cbyD.bssp"
#ERROR : Can't open dsspfile "3bf0C.bssp"
#ERROR : Can't open dsspfile "2c8tA.bssp"
#ERROR : Can't open dsspfile "3cw2M.bssp"

## Summary of PDB Search
:298
    1e-36   9%  3buzA  [x.x.x] IOTA TOXIN COMPONENT IA
    1e-31  23%  2bzrF  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    5e-30  23%  2bzrC  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    2e-29  22%  2bzrB  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    2e-29  22%  2bzrD  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    7e-29  22%  2bzrA  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    1e-28  22%  2a7sA  [x.x.x] PROBABLE PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    3e-21  10%  3bfjA  [x.x.x] 1,3-PROPANEDIOL OXIDOREDUCTASE
    3e-14  13%  2dubE  [c.14.1] 2-ENOYL-COA HYDRATASE
    8e-14  12%  2dubA  [c.14.1] 2-ENOYL-COA HYDRATASE
    2e-13  12%  2a7kE  [x.x.x] CARB
    6e-11  13%  2dubD  [c.14.1] 2-ENOYL-COA HYDRATASE
    1e-07  15%  1dl6A  [g.41.3] TRANSCRIPTION FACTOR II B (TFIIB)
    2e-07  11%  2a7kC  [x.x.x] CARB
    6e-07  13%  3bppA  [x.x.x] 1510-N MEMBRANE PROTEASE
    3e-06  15%  1ef8A  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    9e-06  10%  2a7kG  [x.x.x] CARB
    5e-05  13%  1bnkA  [b.46.1] PROTEIN (3-METHYLADENINE DNA GLYCOSYLASE)
    3e-04  16%  2cbyD  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    3e-04   7%  3bf0C  [x.x.x] PROTEASE 4
    9e-04  19%  2c8tA  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    0.001  12%  3cw2M  [x.x.x] TRANSLATION INITIATION FACTOR 2 SUBUNIT BETA
:298

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxRPRINSMLGRRPEVPENLWIKCPETGEMVFHKDLEDNKWVIPASGYHMKMPAKARLADLFDG
3buzA           ---------------------------------------EDFLKDKENAIQWEKEKNLDTLEKEALELYK
2bzrF           -----------------------HTTAGKLAELHKRREESLHPVGEDAVEKVHAKGKLTARERIYALLDE
2bzrC           -----------------------HTTAGKLAELHKRREESLHPVGEDAVEKVHAKGKLTARERIYALLDE
2bzrB           -----------------------HTTAGKLAELHKRREESLHPVGEDAVEKVHAKGKLTARERIYALLDE
2bzrD           -----------------------HTTAGKLAELHKRREESLHPVGEDAVEKVHAKGKLTARERIYALLDE
2bzrA           -----------------------HTTAGKLAELHKRREESLHPVGEDAVEKVHAKGKLTARERIYALLDE
2a7sA           -----------------------HTTAGKLAELHKRREESLHPVGEDAVEKVHAKGKLTARERIYALLDE
3bfjA           ----------------------------------------------------------------------
2dubE           ----------------------------------------------------------------------
2dubA           ----------------------------------------------------------------------
2a7kE           ----------------------------------------------------------------------
2dubD           ----------------------------------------------------------------------
1dl6A           -----------------SRLDALP--RVTCPNHPDAILVEDYRAGDMICPECGLVVGD------------
2a7kC           ----------------------------------------------------------------------
3bppA           ----------------------------------------------------------------------
1ef8A           ----------------------------------------------------------------------
2a7kG           ----------------------------------------------------------------------
1bnkA           --------------------------------------------------AHSRGGRQTPRNRGMFMKPG
2cbyD           ----------------------------------------------------------------------
3bf0C           ----------------------------------------------------------------------
2c8tA           ----------------------------------------------------------------------
3cw2M           --------GKFSSQVINTLMERFLKAYVECSTCKDTILKKEKKSWYIVCLACGAQTPV------------


                         .         .         *         .         .         .         .:140
query           GIYEALAQPKVAQDPLKFRDSKKYTDRLRDSRAKTEQEDTILAGVGLLKGLKIVAVVHEFQFMAGSLGIA
3buzA           KDSEQISNYSQTRQY--FYDYQIESNPREK---EYKNLRNAISKNKIDKPINVYFESPEKFAFNKEIRTE
2bzrF           DSF-------VELDALAKHRSTNF-----NLGEKRPLGDGVVTGYGTIDGRDVCIFSQDATVFGGSLGEV
2bzrC           DSF-------VELDALAKHRSTNFNL-----GEKRPLGDGVVTGYGTIDGRDVCIFSQDATVFGGSLGEV
2bzrB           DSF-------VELDALAKHRSTNFNLGE-----KRPLGDGVVTGYGTIDGRDVCIFSQDATVFGGSLGEV
2bzrD           DSFVEL-------DALAKHRSTNF-----NLGEKRPLGDGVVTGYGTIDGRDVCIFSQDATVFGGSLGEV
2bzrA           DSF-------VELDALAKHRSTNFNLGE-----KRPLGDGVVTGYGTIDGRDVCIFSQDATVFGGSLGEV
2a7sA           D-------SFVELDALAKHRSTNFNL-----GEKRPLGDGVVTGYGTIDGRDVCIFSQDATVFGGSLGEV
3bfjA           -----------------------AISVVGERCQLLGGKKALLVTDKGLRKDGAVDKTLEVAIFDGVEPNP
2dubE           -----------------------------------------------------------------ALCNG
2dubA           -----------------------------------------------------------------ALCNG
2a7kE           -----------------------------------------------------VRVITDHPNKHNPFSRT
2dubD           -----------------------------------------------------------------ALCNG
1dl6A           ----------------------------------------------------------------------
2a7kC           -----------------------------------------------------------------PFSRT
3bppA           -----------------------------------------------------VYVA----QIKGQITSY
1ef8A           -----------------------------------------------------------------ALSKV
2a7kG           -----------------------------------------------------------------PFSRT
1bnkA           TLYVYIIYGMYFCMNI---------------SSQGDGACVLLRALEPLEGLETMRQLRSRVLKDRELCSG
2cbyD           -------------------------------------------------------------FLGSEVNDE
3bf0C           ------------------------------------------------RGALLLDISGVIVDKPDRLQEN
2c8tA           -------------------------------------------------------------FLGSEVNDE
3cw2M           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AGEAIVKAFERAISERCPLVMFPASGGARMQEGILSLMQLPRTTVAVNMLKEAGMPYIVVLTNPTTGGVT
3buzA           NQNEISLEKFNELKETIQ-------DKLFKQDGFKDVSLYEPGNGDEPLLIHLKLPKNTGMLPYINSNDV
2bzrF           YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSRIFRN-NILASGVIPQISLIMGAAAGGHV
2bzrC           YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSRIFR-NNILASGVIPQISLIMGAAAGGHV
2bzrB           YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSRIFRN-NILASGVIPQISLIMGAAAGGHV
2bzrD           YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGL-YSRIFRNNILASGVIPQISLIMGAAAGGHV
2bzrA           YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGL-YSRIFRNNILASGVIPQISLIMGAAAGGHV
2a7sA           YGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGL-YSRIFRNNILASGVIPQISLIMGAAAGGHV
3bfjA           KDTNVRDGLAVFRREQCDIIVTVGGGCGKGIGIAATHEGDLYQYAGIETLTNPLPPIVAVNTTAGTASEV
2dubE           LIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQHWDHITRIKKPVIAAVNGYALGG-G
2dubA           LIEELNQALETFEEDPAVGAIVLTGGEKAFAAGAMQNRTFQDCYSHWDHITRIKKPVIAAVNGYALGG-G
2a7kE           LETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEVKQLSRLYQAVLNVNKPTIAAVDGYAIGM-G
2dubD           LIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQHWDHITRIKKPVIAAVNGYALGG-G
1dl6A           ----------------------------------------------------------------------
2a7kC           LETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEVKQLSRSYQAVLNVNKPTIAAVDGYAIGM-G
3bppA           TYDQFDRYITIAEQDNEAIIIELDTPGGRADAMMNIVQRIQQ-------SKIPVIIYVYPP-GASAASAG
1ef8A           FIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHELDPLSYDTRMIQKFPKPIISMVEGSVWGGA-
2a7kG           LETSVKDALARANADDSVRAVVVYGGAERSFSAGGDEVKQLSRSEDIEEWIDRVIDPTIAAVDGYAIGMG
1bnkA           PSK-LCQALAINKSFQRDLA--------------------------------------------------
2cbyD           IANRLCAQILLLAAEDKDISLYINSPGGSISAGM----------AIYDTMVLAPCDIATYAMGMAASGEF
3bf0C           SLFDIVNTIRQAKDDRNITGIVMDLKNFAGGDQPSMQYIG-----KALKEFRDSGKPVYAVGENYSQG-Q
2c8tA           IANRLCAQILLLAAEDKDISLYINSPGGSISAGIYDTMVAPCDIATYAMGMAASMGEFLLAAGTKGKRYA
3cw2M           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ASYAMLGDVHIAEPGAEICFAGKRVIEQTIREKLPEGFQTSEYLLEHGMVDMVIDRREIPDTLASMLKIM
3buzA           KTLIEQDYSIKIDKIVRIVIEGKQYIKAEASIVNSLDFKDDVSKGDLWGKENYSDWSNKLTP--------
2bzrF           YSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEMEELGGAHTHMAKSGTAHYAASGEQ--DAFDYVRELL
2bzrC           YSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEVEELGGAHTHMAKSGTAHYAASGEQ--DAFDYVRELL
2bzrB           YSPALTDFVIMVDQTSQMFITGPDVIKTVTEVTMEELGGAHTHMAKSGTAHYAASGEQDAFDYV--RELL
2bzrD           YSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEVEELGGAHTHMAKSGTAHYAASGEQ--DAFDYVRELL
2bzrA           YSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEVEELGGAHTHMAKSGTAHYAASGEQ--DAFDYVRELL
2a7sA           YSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEMEELGGAHTHMAKSGTAHYAASGEQ--DAFDYVRELL
3bfjA           TRHCVLTN---TETKVKFVIVSWRNLPSVSINDPLLMIGKPAALTAATGMDALTHAVEAYISKDANP---
2dubE           CELAMMCDIIYAGEKAQFGQPEILLKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKI
2dubA           CELAMMCDIIYAGEKAQFGQPEILLKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKI
2a7kE           FQFALMFDQRLMASTANFVMPELKHFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVM
2dubD           CELAMMCDIIYAGEKAQFGQPEILLKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKI
1dl6A           ----------------------------------------------------------------------
2a7kC           FQFALMFDQRLMASTANFVMPELKHFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVM
3bppA           TYIALGSHLIAMAPGTSIGACRPILATIAEEFITKDLSLTPEEALKYGVIEVVARDINELLKKSNGMKIP
1ef8A           FEMIMSSDLIIAASTSTFSMTPVNLFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAH--
2a7kG           FQFALMFDQRLMASTANFVMPELKHFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVM
1bnkA           ----------------------------------------------------------------------
2cbyD           LLAAGTKGKRYALPHARILMHQPIAIQAEQFAVIKKEMFTAAEALEYGFVDHIITRAHV-----------
3bf0C           YYLASFANKIWLSPQGVVDLHGFDKLKVSTHVFRVGTYKSAVEPFIRDDMSPAAREADSRWIGELWQNYL
2c8tA           LPHARIL---MHQPLIAIQAEQFAVIKKEMFRLNAEFWFTAAEALEYGFVDHIITRAH------------
3cw2M           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TKAPADNANAVxxxxxxx
3buzA           ------------------
2bzrF           SYLPPNNSTDA-------
2bzrC           SYLPPNNSTDA-------
2bzrB           SYLPPNNSTDA-------
2bzrD           SYLPPNNSTDA-------
2bzrA           SYLPPNNSTDA-------
2a7sA           SYLPPNNSTDA-------
3bfjA           ------------------
2dubE           ANNSKI------------
2dubA           ANNSKI------------
2a7kE           ASYPAS------------
2dubD           ANNSKI------------
1dl6A           ------------------
2a7kC           ASYPA-------------
3bppA           VNGR--------------
1ef8A           ------------------
2a7kG           ASYPAS------------
1bnkA           ------------------
2cbyD           ------------------
3bf0C           NTVAAN------------
2c8tA           ------------------
3cw2M           ------------------