[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK85965.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1ea0A.bssp"
#ERROR : Can't open dsspfile "1ecfB.bssp"
#ERROR : Can't open dsspfile "1ecbC.bssp"
#ERROR : Can't open dsspfile "1bllE.bssp"
#ERROR : Can't open dsspfile "2bplA.bssp"
#ERROR : Can't open dsspfile "1eccA.bssp"
#ERROR : Can't open dsspfile "3e59A.bssp"
#ERROR : Can't open dsspfile "1ecbB.bssp"
#ERROR : Can't open dsspfile "2bggB.bssp"
#ERROR : Can't open dsspfile "1ecbD.bssp"
#ERROR : Can't open dsspfile "1ecbA.bssp"
#ERROR : Can't open dsspfile "3b9tD.bssp"
#ERROR : Can't open dsspfile "1cb0A.bssp"
#ERROR : Can't open dsspfile "2a7rA.bssp"
#ERROR : Can't open dsspfile "1ao0A.bssp"
#ERROR : Can't open dsspfile "2bwgA.bssp"
#ERROR : Can't open dsspfile "2bleA.bssp"
#ERROR : Can't open dsspfile "2a7rC.bssp"
#ERROR : Can't open dsspfile "2a7rD.bssp"
#ERROR : Can't open dsspfile "1b3oB.bssp"
#ERROR : Can't open dsspfile "2bwgB.bssp"
#ERROR : Can't open dsspfile "2bh1A.bssp"
#ERROR : Can't open dsspfile "2bwgD.bssp"
#ERROR : Can't open dsspfile "2a1yA.bssp"
#ERROR : Can't open dsspfile "2a7rB.bssp"
#ERROR : Can't open dsspfile "2e77B.bssp"
#ERROR : Can't open dsspfile "2bznA.bssp"
#ERROR : Can't open dsspfile "2bznD.bssp"
#ERROR : Can't open dsspfile "2drhB.bssp"
#ERROR : Can't open dsspfile "2c6qA.bssp"
#ERROR : Can't open dsspfile "1eepB.bssp"
#ERROR : Can't open dsspfile "2du2A.bssp"
#ERROR : Can't open dsspfile "2c6qG.bssp"
#ERROR : Can't open dsspfile "1eepA.bssp"
#ERROR : Can't open dsspfile "2e77C.bssp"
#ERROR : Can't open dsspfile "2bznB.bssp"
#ERROR : Can't open dsspfile "3bw2A.bssp"
#ERROR : Can't open dsspfile "2bznC.bssp"
#ERROR : Can't open dsspfile "2cu0B.bssp"
#ERROR : Can't open dsspfile "2a4aB.bssp"
#ERROR : Can't open dsspfile "2e77A.bssp"
#ERROR : Can't open dsspfile "2a4aA.bssp"
#ERROR : Can't open dsspfile "2cu0A.bssp"
#ERROR : Can't open dsspfile "3bm5B.bssp"
#ERROR : Can't open dsspfile "1ak5A.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "2c6qB.bssp"
#ERROR : Can't open dsspfile "3eisB.bssp"
#ERROR : Can't open dsspfile "3c61A.bssp"
#ERROR : Can't open dsspfile "3bw3A.bssp"
#ERROR : Can't open dsspfile "2droA.bssp"
#ERROR : Can't open dsspfile "1al7A.bssp"
#ERROR : Can't open dsspfile "3e59D.bssp"
#ERROR : Can't open dsspfile "3e59B.bssp"
#ERROR : Can't open dsspfile "2e68A.bssp"
#ERROR : Can't open dsspfile "1d6sA.bssp"
#ERROR : Can't open dsspfile "3b9tA.bssp"
#ERROR : Can't open dsspfile "2b4gB.bssp"
#ERROR : Can't open dsspfile "1d3hA.bssp"
#ERROR : Can't open dsspfile "1b3oA.bssp"
#ERROR : Can't open dsspfile "1ea0A.bssp"

## Summary of PDB Search
:1782
    6e-47  25%  1ea0A  [d.153.1 - c.1.4 - b.80.4] GLUTAMATE SYNTHASE [NADPH] LARGE
    4e-28  14%  1ecfB  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
    7e-26  13%  1ecbC  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
    5e-25  14%  1bllE  [c.50.1 - c.56.5] LEUCINE AMINOPEPTIDASE
    3e-23  13%  2bplA  [d.153.1 - c.80.1 (1jxaA)] GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE
    5e-22  14%  1eccA  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
    1e-21   7%  3e59A  [x.x.x] PYOVERDINE BIOSYNTHESIS PROTEIN PVCA
    2e-21  13%  1ecbB  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
    1e-19  10%  2bggB  [x.x.x] PROTEIN AF1318
    5e-19  13%  1ecbD  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
    8e-19  12%  1ecbA  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
    8e-18  15%  3b9tD  [x.x.x] TWIN-ARGININE TRANSLOCATION PATHWAY SIGNAL
    9e-18  11%  1cb0A  [c.56.2] PROTEIN (5'-DEOXY-5'-METHYLTHIOADENOSINE
    2e-17  13%  2a7rA  [x.x.x] GMP REDUCTASE 2
    2e-16  15%  1ao0A  [d.153.1 - c.61.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE
    3e-16   9%  2bwgA  [x.x.x] GMP REDUCTASE I
    5e-16   9%  2bleA  [x.x.x] GMP REDUCTASE I
    9e-16  11%  2a7rC  [x.x.x] GMP REDUCTASE 2
    9e-16  11%  2a7rD  [x.x.x] GMP REDUCTASE 2
    1e-15  10%  1b3oB  [c.1.5 - d.37.1 - d.37.1] PROTEIN (INOSINE MONOPHOSPHATE
    2e-15   9%  2bwgB  [x.x.x] GMP REDUCTASE I
    3e-15  14%  2bh1A  [x.x.x] GENERAL SECRETION PATHWAY PROTEIN L
    4e-15  10%  2bwgD  [x.x.x] GMP REDUCTASE I
    5e-15  11%  2a1yA  [x.x.x] GMP REDUCTASE
    6e-15  11%  2a7rB  [x.x.x] GMP REDUCTASE 2
    5e-14  10%  2e77B  [x.x.x] LACTATE OXIDASE
    1e-13  12%  2bznA  [x.x.x] GMP REDUCTASE 2
    2e-13  14%  2bznD  [x.x.x] GMP REDUCTASE 2
    2e-13  10%  2drhB  [x.x.x] 361AA LONG HYPOTHETICAL D-AMINOPEPTIDASE
    2e-13  13%  2c6qA  [x.x.x] GMP REDUCTASE 2
    3e-13  14%  1eepB  [c.1.5] INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
    7e-13  11%  2du2A  [x.x.x] LACTATE OXIDASE
    7e-13  13%  2c6qG  [x.x.x] GMP REDUCTASE 2
    2e-12  15%  1eepA  [c.1.5] INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
    2e-12  15%  2e77C  [x.x.x] LACTATE OXIDASE
    3e-12  13%  2bznB  [x.x.x] GMP REDUCTASE 2
    4e-12  13%  3bw2A  [x.x.x] 2-NITROPROPANE DIOXYGENASE
    6e-12  13%  2bznC  [x.x.x] GMP REDUCTASE 2
    8e-12  12%  2cu0B  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    4e-11  16%  2a4aB  [x.x.x] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    7e-11  16%  2e77A  [x.x.x] LACTATE OXIDASE
    2e-10  12%  2a4aA  [x.x.x] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    3e-10  12%  2cu0A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    4e-10  13%  3bm5B  [x.x.x] CYSTEINE SYNTHASE
    9e-10  11%  1ak5A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    1e-09  14%  1d3gA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    2e-09  12%  2c6qB  [x.x.x] GMP REDUCTASE 2
    4e-09  18%  3eisB  [x.x.x] ARYLMALONATE DECARBOXYLASE
    1e-08  15%  3c61A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-08  10%  3bw3A  [x.x.x] 2-NITROPROPANE DIOXYGENASE
    2e-08   9%  2droA  [x.x.x] XYLANASE Y
    1e-07  17%  1al7A  [x.x.x] GLYCOLATE OXIDASE
    2e-07  13%  3e59D  [x.x.x] PYOVERDINE BIOSYNTHESIS PROTEIN PVCA
    7e-07  10%  3e59B  [x.x.x] PYOVERDINE BIOSYNTHESIS PROTEIN PVCA
    1e-06  13%  2e68A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-06  11%  1d6sA  [c.79.1] O-ACETYLSERINE SULFHYDRYLASE
    3e-06  14%  3b9tA  [x.x.x] TWIN-ARGININE TRANSLOCATION PATHWAY SIGNAL
    4e-06  15%  2b4gB  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    7e-06  13%  1d3hA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    2e-05  12%  1b3oA  [c.1.5] PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2)
    4e-07  46%  1ea0A  [d.153.1 - c.1.4 - b.80.4] GLUTAMATE SYNTHASE [NADPH] LARGE(query 931->1098)
:1782

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxVGDGAGVSLDLSLSFFRELTGDAALPAGRFGVGNFFLPQNPAFHGEAVGIIGNALKEQGFSVLLV
1ea0A           -----TGDGAGIHVAVPQKFFKDHVKVIGHPDNKLAVGQVFLPRISLDAQEACCIVETEILAFGYYIYGW
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RDVPVNDTAIRPAAIPYQLPIRQWVFSAPVECATLAEFDWRIHKALLAIEALAYTVPDLAGFYPLSLSAR
1ea0A           RQVPINVDIIGEKANATRPEIEQIIVGNNKGVSDEQFELDLYIIRRRIEKAVKGEQIND--FYICSLSAR
1ecfB           -------------------------------------------SIYDALTVLQHRGQDAAGIITIDANNC
1ecbC           -------------------------------CGIVGIAGVMNQSIYDALTVLQHRGQDAAGIITIDANNC
1bllE           ----------------------------------------------------------------------
2bplA           ---------------------------------------------LEGLRRLEYRGYDSAGLAVVDAEGH
1eccA           -------------------------------CGIVGIAGVMNQSIYDALTVLQHRGQDAAGIITIDANNC
3e59A           ----------------------------------------------------------------------
1ecbB           -------------------------------CGIVGIAGVMNQSIYDALTVLQHRGQDAAGIITIDANNC
2bggB           ----------------------------------------------------------------------
1ecbD           -------------------------------CGIVGIAGVMNQSIYDALTVLQHRGQDAAGIITIDANNC
1ecbA           -------------------------------CGIVGIAGVMNQSIYDALTVLQHRGQDAAGIITIDANNC
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           -------------------------------------------ITYYGLHSLQHRGQEGAGIV-ATDGEK
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TQVLKGRLNSQEVMPYFCDLTDPRHKVHTMYFHTRFSTNTDPHPSMAQPFRLMAHNGELNTDKKNRLSEA
1ea0A           SIIYKGMFLAEQLTTFYPDLLDERFESDFAIYHQRYSTNTFPTWPLAQPFRMLAHNGEINTVKGNMEHPA
1ecfB           FRLRKANGL---VSDVFEARHMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPYGITLAHNGNLTAHE
1ecbC           FRLRKANGL---VSDVFEARHMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPYGITLAHNGNTNAHE
1bllE           ----------------------------------------------------------------------
2bplA           MTRLRRLGKVQMLAQ---AAEEHPLHGGTGIAHTRWATHGEPSEVNAHPHVSVVHNGIIENHEPLREELK
1eccA           FRLRKANGL---VSDVFEARHMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPYGITLAHNGNLTNHE
3e59A           ----------------------------------------------------------------------
1ecbB           FRLRKANGL---VSDVFEARHMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPYGITLAHNGNL----
2bggB           --------------------------TYRIGNGASVPISNTGELIKGLRNYYEVPSLKLIHNSSLQISSK
1ecbD           FRLRKANGL---VSDVFEARHMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPYGITLAHNGNLTNHE
1ecbA           FRLRKANGL---VSDVFEARHMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPYGITLAHNGNLTNHE
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           LTAHKGQ---GLITEVFQNGELSKVKGKGAIGHVRYA----TGYENVQPLLFRSQNNGSLALAHNGNLVN
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AVALAKNASIVRPKGQSDSCRLDQTLQARVMEDGLDLVTAVVSMMPPAWENDDTLSPGVKSMLEYFSLYE
1ea0A           FGTHMQDLKPVIGVGLSDSGSLDTVFEVMVRA-GRTAPMVKMMLVPQALTT---TPDNHKALIQYCNSVM
1ecfB           LRKKLFEEKRRHINTTSDS-------------------EILLNIFASELDNFRHYPLEADNIFAAIAATN
1ecbC           LRKKLFEEKRRHINTTSDS-------------------EILLNIFASELDNFRHYPLEADNIFAAIATNR
1bllE           ----------------------------------------------------------------------
2bplA           A-------RGYTFVSETDTEVIAHLV-NWELKQGGTLREAVLRAIPQL----------------------
1eccA           LRKKLFEEKRRHINTTSDS-------------------EILLNIFASELDNFRHYPLEADNIFAAIATNR
3e59A           ----------------------------------------------------------------------
1ecbB           -----TNAHELRKKLFEEKRRHINTTSDS---------EILLNIFASELDNFRHYPLEADNIFAAIAATN
2bggB           IDEVWHIHNINISEFIYDSPHFDSIKSQNAIDTGVDGIM----LVLPEYNTPLYYKLKSYLINSIPSQFM
1ecbD           LRKKLFEEKRRHINTTSDS-------------------EILLNIFASELDNFRHYPLEADNIFAAIATNR
1ecbA           LRKKLFEEKRRHINTTSDS-------------------EILLNIFASELDNFRHYPLEADNIFAAIAATN
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           ATQLKQQLENSIFQTSSDTEVLAHLIKRSGHFTLKDQIKNSLSMLKGAY---------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EKNDGPAALIFGDGTIIGARLDRLGLRPLRTVETDDYLCVMSEAGQIAFPAESVIRRGRIEAGGMLYYDH
1ea0A           EPWDGPAALAMTDGRWVVGGMDRNGLRPMRYTITTDGLIIGSETGMVKIDETQVIEKGRLGPGEMIAVDL
1ecfB           RLIRGAYACAMIIGHGMVAFRDPNGIRPLVLGKRDIDENRTEYVASESVALDTLGFDFLRDVAPGEAIYI
1ecbC           LIRGAYACVAMIIGHGMVAFRDPNGIRPLVLGKRDIDEMVASESVALDTLGFDFLRDVAPGEAIYITEEG
1bllE           ----------------------------------------------------------------------
2bplA           ---RGAYGTVIMDSRHPDTLLAARSGSPLVIGLGMGENFIASDQLALLPV---TRRFIFLEEGDIAEITR
1eccA           LIRGAYACVAMIIGHGMVAFRDPNGIRPLVLGKRDIDENRTEYASESVALDTLGFDFLRDVAPGEAIYIT
3e59A           ----------------------------------------------------------------------
1ecbB           RLIRGAYACVAMIIGHMVAFRDPNGIRPLVLGKRDIDENRTEYMVASESVALDTLDFLRDVAPGEAIYIT
2bggB           RSNRNLTFYVDFVSKLGGKPWILNVDPEKGSDTRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTY
1ecbD           LIRGAYACVAMIIGHGMVAFRDPNGIRPLVLGKRDIDENRTEYMVASESVALDTLGFDFLRDVAPGEAIY
1ecbA           RLIRGAYACVAMIGHGMVAFRDPNGIRPLVLGKRDIDENRTEYMVASESVALDTLGFDFLRDVAPGEAIY
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           -------AFLIMTETEMIVALDPNGLRPLSIGMMGDAYVVASETCAFDVVGATYLR--EVEPGEMLIIND
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TERRAFSTVEALELLASRRDYSSLLSDARVMLGDLPEVPADKQGSPLRYNGDLERHQRYVAYSHNQESFK
1ea0A           QSGKLYRDRELKDHLATLKPWDKWVQNTTHLDELVKTASLKGEPSDMDKAELRRRQQAFG---LTMEDME
1ecfB           TEEGQLFTRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIAREIPETSCDIALEIA
1ecbC           QLFTRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSAEKIAREWEDLDIDVVIPIPETSCDI--ALEIA
1bllE           ----------------------------------------------------------------------
2bplA           RSVNIFDKTGAEVKRQDIESNLQYDAGDKGIYRHYMQKEIYEQPNAIKN-----TLTGRISHGQVDLSEL
1eccA           EEGQLFTRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSARV----NMGTKLGEKIAREWEDLDIDVVI
3e59A           ----------------------------------------------------------------------
1ecbB           EEGQLFTRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSARV-------NMGTKLGEKIAREWEDLDID
2bggB           LKSTIKKVVYGFKKSNPDW---------------DVEKLT------LHVSGKRPKMKDGETKILKEEELK
1ecbD           ITEEGQLFTRQCADNPVSNPCLFEYVYFARP---------DSFIDKISVYSARVNMGTKLGEKIAREWED
1ecbA           ITEEGQLFTRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIAREWEDLPIPETSCD
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           EGMKSERFSMNINRSICSMEY--------IYFSRPDSNIDGINVHSARKNLGKMLAQESAVEADVVTGVP
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FLMDPMLASGAEKISAMGYGNAINALSDQEGGVAKYFSQRFAQVTNPPLDSIREADGMTLRVALGAKPNS
1ea0A           LILHPMVEDGKEAIGSMGDDSPIAVLSDKYRGLHHFFRQNFSQVTNPPIDSLRERRVMSLKTRLGNLGNI
1ecfB           RILGKPYRQGFVKNRYVGRTFIMPGQQLRRKSVRRKLNANRAEFRDKNVLLVSIVRGTTSEQIIEMAREA
1ecbC           RILGKPYRQGFVKNRYVGRTFIMPGQQLRRKSVRRKLNANRAEFRD-KNVLLVDDSIVRGTTSEQIAREA
1bllE           ----------------------------------------------------------------------
2bplA           GPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRAVRRNSLMITLSQSGETADA
1eccA           PIPETSCDIALEIARIL-------GKPYRQGFVKNRYVGRTFIMGQQLRRKSVRRKLNANRAEF------
3e59A           ----------------------------------------------------------------------
1ecbB           VVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMSVRRKLNANRAEFRDKNVLLVDDSIVRGTT
2bggB           KQE-MVSRDVKYAILHLNETHPFWVMGTKVKLSSKRYLLTLLQVTPIKPLSVE-----------------
1ecbD           LDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRTFIMSVRRKLNANRAEFRVRGTTSEQIIEMAREA
1ecbA           IALEIARILGKPYRQGFVKNRYVGRTFIMPKSVRRKLNANRAEFRDKNVLLVSIVRGTTSEQIIEMAREA
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           DSSISAAIGYAEATGIPYELGLIKNRYVFIQPSQALREQGVRMKLSAVRGVVEGVRGTTSRRIVTMLREA
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GAKKARQIVVRSPILTHLDMLRIREQPETPVRRFEMLYTPVFDAEDANEAALRQAIDGLCGEVVAFAAEE
1ea0A           LDEDERLLQLESPVLTTAEFRAMRDYMGDTAAEIDATFPVDGGPEALRDALRRIRQET------EDAVRG
1ecfB           GAKKVYLASAAPEIRFPIDMPSATELIAHGREVDEIRQILIFQDLNDLIDAVRAENPDIQQFECSVFNGV
1ecbC           GAKKVY-LASAAPEIRFPNVYGI-----------------------------------------------
1bllE           ----------------------------------------------------------------------
2bplA           GLRLSKLGYLGSLAICNVPGSSLVR-----------ESDLALMTNAGTEI--------GVASTKAFTTQL
1eccA           --RDKNVLLVDDSIVRGTTSEQIIE---------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           SEQIIEMLASAAPEIRFPNVYGIDMPVDEIRQIIGADGLIFQDLNDLIDAVRAENPDI------------
2bggB           ----------------------------------------------------------------------
1ecbD           GAKKVYLASA-APEIRFPNVYGIDM---------------------------------------------
1ecbA           GAKKVYL-ASAAPEIRFPNVYGI-----------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           GATEVH-VKISSPPIAHPCFYGI----DTSTHEELIASSHSVEEIRQEIGADTLSFLSVEGLLKGIGRKY
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GGIAVVTDRHVSAGRAALPMIMVVSAINQRLIEEGLRLRISLIVESGQFSSSHHIAAGLGFGASAVYPLG
1ea0A           GTHVILTDEAMGPARAAIPAILATGAVHTHLIRSNLRTFTSLNVRTAEGLDTHYFAVLIGVGATTVNAYL
1ecfB           YVTK-DVDQGYLDFLDTLRNDDAKAVQRQNEVE-------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ----------------------------------------------------------------------
2bplA           TVLLMLVAKLSKLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPI-
1eccA           ----------------------------------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           DDSNCGQCLACFTGKYPTEIYQ------------------------------------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           VQFRAEXXXXXXXXXXXXXXXXXXXXSLMKTMGKVGLCTAESYIGGEFFEPNFLDTSDPVLKRYFPNVKT
1ea0A           AQEAIALFGSMPLEKGMANYKKAIDDGLLKIMSKMGISVISSYRGGGNFE--AIGLSRALVAEHFPAMVS
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           PVGGVTFAVIAQAVADWHRKALSVKGENDIPLLGLFKERAEGAGHSYGTTAVRGFVDMTEEKIGFDKGTE
1ea0A           RISGIGLNGIQKKVLEQHATAYN-EEVVALPVGGFYRFRKSGDRHGWEGGVIHTLQQA-----VTNDSYT
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           NEEALRLLPLNRLEDAFGLNDAAYYHNSFDRLTPDAIDAFEVTPGYXXXXXXXXXXXXXXXXXXXDVLEL
1ea0A           TFKKYS-------EQVNKRPPMQLRDLLELRSTKAPVPVDEVESITAIRKRF-----------------I
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           PADVTFAGSAEEFRREMGRFCRHGNNSFMVRGLRCDEAADGSFRLQLIGPHGHELARLAALGQSLLDRFD
1ea0A           TPGMSMGALSPELNVAMNRIGAKSDSGEGGEDFRPDKNGDNWNSAIKQVASGRFGVTAEYLNQCRELEIK
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           DDIAGHWLEGGALxxxxxxxAFAYMSLIRTAPNSIPLETVQKASEITKTLASGAMSXXXXXXXXXXXXXX
1ea0A           VAQGAKPGEGGQL---------------------------------------------------------
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           -------------------------------------------SALTDLFPLPIVQAPMAGGVSVPQLAA
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           -------------------------------------------SALTDLFPLPIVQAPMAGGVSVPQLAA
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           --------------------QLRDLLELRSTKAPVPVDEVESITAIRKRFITPGMSMGALSPEAHGTLNV


                         .         *         .         .         .         .         +:1050
query           XTNMVGGMSNSGEGGEHISRYGTIRASRIKQFASGRFGVWAGYLADPMLEEIEIKIGQGAKPGEGGQLPS
1ea0A           ----------------------------------------------------------------------
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           -KGKTFGSNVAANWGFHYNELIEEPVVTIYELDATGERNWARAFYNYR--WTPQKDPFG-VVHPIVDYPG
1cb0A           --------------------------------GTGLDDPEILEGRT--EKYVDTPFGKPSDALILGKIKN
2a7rA           --VLLRPKRSTLKSRSEVDLTRSFTYSGVPIIAANMDTVG-------TFEMAKVLCKFSLFTAVHKHYSL
1ao0A           ----------------------------------------------------------------------
2bwgA           --RTFTFRNSKQTYSGIPIIVANMFEMAAVMSQHSMFTAIHKHYSLD--DWKLFATNHPECLQNVAVSSG
2bleA           --RTFTFRNSKQTYSGIPIITVGTFEMAAVMSQHSMFTAIHKHYSLD--DWKLFATNHPECLQNVAVSSG
2a7rC           --VLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSL
2a7rD           --VLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSL
1b3oB           -----REDLVVAPAGITLKEANEIKGKLPIVNEDDELVAIIARTDL--KKNRDYPLASKDAKKQLLCGAA
2bwgB           --RTFTFRNSKQTYSGIPIITVGTFEMAAVMSQHSMFTAIHKHYSLD--DWKLFATNHPECLQNVAVSSG
2bh1A           ----------------------------------------------------------------------
2bwgD           -ERTFTFRNSKQTYSGIPIIVANMFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSG
2a1yA           --------------------TIIDERIATYLAENNYFYIMHRFQPEKRISFIRDMQS---RGLIASISVG
2a7rB           --VLLRPKRSTLKSRSEVDLTRSFTYSGVPIIAANMDTVGTFEMAKVLCK-------FSLFTAVHKHYSL
2e77B           ----FGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRKSDGATAIILTADSTVSGNRDRDVK
2bznA           -----------------SFRNSKQTYSGVPIIAANMDTVGTFEMA-------KVLCKFSLFTAVHKHYSL
2bznD           -------------------RNSKQTYSGVPIIAANMDTVGTFEMAKVLCK-------FSLFTAVHKHYSL
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------SLFTAVHKHYSL
1eepB           --------------------------SIEAQRKEIEKVKTYDFPNA--CKDLNNKLRVGAAVS-----ID
2du2A           --SEFGTIMSISAYSGATFEEISEGLNGFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGNRDRD
2c6qG           ------------------TRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCK--FSLFTAVHKHYSL
1eepA           -----------------------------------------------ACKDLNNKLRVGAAVSIDIDTI-
2e77C           -----RAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDD--QQNRDILDEAKSDGATAIILT
2bznB           -------------------RNSKQTYSGVPIIAANMDTVGTFEMAKVLCK-------FSLFTAVHKHYSL
3bw2A           AVCEAGGLGFLAAGYKTADGMYQ-EIKRLRGLTGRPFGVNVFMPQPE--LGAVEVYAHQLAGEAAWYETE
2bznC           --------------------------SGVPIIAANMDTVGTFEMAKVLCK-------FSLFTAVHKHYSL
2cu0B           -------LSAAMDTVTEWEMAVAMAREGGLGVIHRNMGIEEQVEQVKR--VKRAKYKNAVRDENGELLVA
2a4aB           ---------------------------AAVCVYPKFVKFINEKIKQEINP-FKPKIACVINFPYGTDSME
2e77A           -------------TIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDD--QQNRDILDEAKSDGATAIIL
2a4aA           --------------------------AAAVCVYPKFVKFINEKIKQ-EINPFKPKIACVINFPYGTDSME
2cu0A           -----------MDTVTEWEMAVAMAREGGLGVIHRNMGIEEQVEQVK--RVKRAEKYKNAVRDENGELLV
3bm5B           -------------------------------------------------------------------SPR
1ak5A           -----------------------------------------------------ELVDSQKRYLVGAGINT
1d3gA           ---EIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGGLSVVEHRLRARQQKQAKLTEDGLPLGLGKNKTSV
2c6qB           ----------------------------------------------------------SLFTAVHKHYSL
3eisB           ----------------------------------------------------------------------
3c61A           ---------------------------------------RLAAVATEKGVILELNLSCPNVPGKPQVAYD
3bw3A           AVCEAGGLGFLAAGYKTADGMYQ-EIKRLRGLTGRPFGVNVFMPQPE--LGAVEVYAHQLAGEAAW----
2droA           --------------------------------ASHRWEQPFNYSEQ--ARKLLHTCVHEGGPGHPMWNRD
1al7A           --------SAAGTIMTL----SSWATSSVEEVASTGPGIRFFQLYVYK-DRNVVAQLVRRAERAGFKAIA
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           -----GALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGF--DFYLKYASDLHDYSKKPLFLSISG
1d6sA           ----------------------------------------------------------------------
3b9tA           --GSNVAANWGFHYNELIEEPKKREVVTIYELDATGERNWARAFYNYR--WTPQKDPFG-VVHPIVDYPG
2b4gB           ----------------------SMSGLSVEESVEMVKKLV--PITKEKGTILELNLSCPNVPGKPQVGYD
1d3hA           -----------------------------------------------------------GVNLGKNKTSV
1b3oA           --------------------------------------------------VKDYPLASKDAKKQLLCGAA
1ea0A           AMNRIGAKSDSGEGGEDPARFRPDKNSAIKQVASGRFGVTAEYLNQCR--ELEIKVAQGAKPGEGGQLPG


                         .         .         .         .         *         .         .:1120
query           PKVTVEIAAARGGTPGVELVSPPPHHDTYSIEDLAQLIHDAKAARVRVIVKLVSSEGIGTIAVGVAKAGA
1ea0A           ----------------------------------------------------------------------
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           VPVDHSTISKNYNVLKNIRVPVRPHFGTGLAPKEADL-VNSVPPSHFGGNIDNWRIGKGATYYPVSVAGG
1cb0A           VDCVL-------------LARHGRQHTIMPSKVYQANIWALKEEGCTIVTTACGSPGDIVIIDQFIDRTT
2a7rA           VQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYKRFPQHTIMAGNVVTGEMVEELILSGA
1ao0A           ----------------------------------------------------------------------
2bwgA           SGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAK-FPEHTIMAGNVVTGEMVEELILSGA
2bleA           SGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAK-FPEHTIMAGNVVTGEMVEELILSGA
2a7rC           VQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKDVRKRFPQHTIMAGNVVTGEMVEELILS
2a7rD           VQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKDVRKRFPQHTIMAGNVVTGEMVEELILS
1b3oB           IGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI-GGNVVTAAQAKNLIDAGV
2bwgB           SGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAK-FPEHTIMAGNVVTGEMVEELILSGA
2bh1A           ----------------------------------------------------------------------
2bwgD           QNDLEKMTSILEAVPQVKFICLDVANG--YSEHFVEFVKLVRAK-FPEHTIMAGNVVTGEMVEELILSGA
2a1yA           VKEDEYEFVQQLAAEHLTPEYITIDIAHGHSNAVINMIQHIKKH-LPESFVIAGNVGTPEAVRELENAGA
2a7rB           VQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVAQHTIMAGNVVTGEMVEELILS
2e77B           NKFVYPFGMPIVQRYLRGTAEGMSLNNIYGASKQKISPRDIEEIAGHSGLPVFVKGIQHEDADMAIKRGA
2bznA           VQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKDVRKRFPQHTIMAGNVVTGEMVEELILS
2bznD           VQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYKRFPQHTIMAGNVVTGEMVEELILSGA
2drhB           ----------------------------------------------------------------------
2c6qA           VQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYKRFPQHTIMAGNVVTGEMVEELILSGA
1eepB           IDTIERVEELVKAHVDILVIDSAHGHSTRIIELIKKIK--TKYPNLDLIAGNIVT---KEAALDLISVGA
2du2A           VKNKFVYPFGIVQRYLRGTAEGMSLNNIYGASKQKISPRDIEEIAGHSGLPVFVKGIQHEDADMAIKRGA
2c6qG           VQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYKRFPQHTIMAGNVVTGEMVEELILSGA
1eepA           ------ERVEELVKAHVDILVIDSAHGH--STRIIELIKKIKTKNLDLIAGNIVTKEAALDL---ISVGA
2e77C           ADSTVSGNRDRDVKNKF----VYPFGMIYGASKQKISPRDIEEIALPVFVKGIQH---PEDADMAIKRGA
2bznB           VQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYKRFPQHTIMAGNVVTGEMVEELILSGA
3bw2A           LGDPDGGRDDGYDAKLAVLLDDPVPVVSFHFGVPDRVIARLRRAGTLTLVTATTPEE----ARAVEAAGA
2bznC           VQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLPQHTIMAGNVVTGEMVEELILSGA
2cu0B           AAVSPFDIKLDKAGVDVIVVDTAHAHNLKAIKSMKEMRQ---KVDADFIVG-----NIANPKAVDDLTFA
2a4aB           KVLNDTEKALDDGADEIDLVINYKKNTDEGLKEATKLTQSVKKLLTNKILKLKTEDLIIKTTLAVLNGNA
2e77A           TAVSGNRDRDVKNKFVYPFGMPIVQNNIYGASKQKISPRDIEEIALPVFVKGIQH---PEDADMAIKRGA
2a4aA           KVLNDTEKALDDGADEIDLVINYKKIIENTDKLTQSVKKLLTNKILKVIIELKTEDLIIKTTLAVLNGNA
2cu0A           AAAVSPFDIKRAIGVDVIVVDTAHAHNLKAIKSMKEMR---QKVDADFIVG-----NIANPKAVDDLTFA
3bm5B           KRIYHNILETIGGTPLVELHGVTEH---PRIKKGTRILVKLEYFNPMSSVKDRVGFNIVYQAIKDGRLKP
1ak5A           RDFRERVPALVEAGADVLCIDSSDGFSEWQKITIGWIR-EKYGDKVKVGAGNIVDG---EGFRYLADAGA
1d3gA           DAAEDYAEGVRVLGPYLVVNVSSPNTAGLGKAELRRLLTKVRVHRPAVLVKIAPSQDKEDIASVVKELGI
2c6qB           VQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKDVRKRFPQHTIMAGNVVTGEMVEELILS
3eisB           -------------TPTIGMIVPPAAGLVP--ADGARLYPDLPFIASGLGLGSVTPEGVVDHARRLQKQGA
3c61A           FDAMRQCLTVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPQVQFITCI--------NSIGNGLVIDAE
3bw3A           ----------------------------------------------------------------------
2droA           NKLIKFIPEVEF-----------SDPSYHLPHFYELFSLWANEEDRVFWKEAASREYLKIACHPETGLAP
1al7A           LTVDTPRLGRREADIKNRFV-LPPFLTLKNFEGIDLGLSSYVAGQIDDVAWLQTITSLPILVKGVITAED
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           LSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDAYGLPFGVKMPPYFDIAHFDTAAAVLNE
1d6sA           -KIYEDNSLTIGHTPLVRL-NRIGNGRILAKVESRNPSFSV---------ACRIGANMIWDAEKRGVLKP
3b9tA           VPVDHSTISKNYNVLKNIRVPVRPHFGTGLAPKEADLVN-------------------------------
2b4gB           FDTTRTYLQKSEAYGLPFGVKMPPYFDIAHFDMAAAVLNDF------PLVKFITCVNSIGNGLVIDPANE
1d3hA           DAAEDYAEGVRVLGPLADYLNTAGLRSLQGKAELRRLLTKVLVHRPAVLVKIAPDQDKEDIASVVKELGI
1b3oA           IGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTA-AQAKNLIDAGV
1ea0A           FKVTEMIARLRHSTPGVMLISPPPHHDIYSIEDLAQLIYDLKQINPDA----------------------


                         .         .         +         .         .         .         .:1190
query           DVIXXXXXXXXXXXXXXXSLKYTGRAAEIGIAEVHQALCATGLRAKVLLRCSGAHQTASDVVKSALLGGD
1ea0A           ----------------------------------------------------------------------
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           LFS-------------------------------------------------------------------
1cb0A           MRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTRFSSRAESFMFRTWGAD
2a7rA           DIIKVGIGPGSVCTTRKK--TGVGYPQLSAVMECADAA----HGLKGHIISDGGCSCPGDVAKAFGAGAD
1ao0A           ----------------------------------------------------------------------
2bwgA           DIIKVGVGPGSVCTTRTKTGVGYPQLSAV------IECADSAHGLKGHIISDGGCTCPGDVAKAFGAGAD
2bleA           DIIKVGVGPGSVCTTRTKT------GVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGAD
2a7rC           GADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGH----IISDGGCSCPGDVAKAFGAGAD
2a7rD           GADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHI----ISDGGCSCPGDVAKAFGAGAD
1b3oB           DALRVGMGSGSICITQ--EVLACGRPQATAVYKVSEYA----RRFGVPVIADGGIQNVGHIAKALALGAS
2bwgB           DIIKVGVGPGSVCTTRTKTGVGYPQLSAV------IECADSAHGLKGHIISDGGCTCPGDVAKAFGAGAD
2bh1A           ------------------SQKEADIPWLVWSAEQQEVIASGQVAGWEALHEIESYADQRSVV--VLLAAS
2bwgD           DIIKVGVGPGSVCTTRTKTGVGYPQLSAV------IECADSAHGLKGHIISDGGCTCPGDVAKAFGAGAD
2a1yA           DATKVGIGPGKVCITKIKTGFGTGGWQLAALRWCAKAA-------SKPIIADGGIRTNGDVAKSIRFGAT
2a7rB           GADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLK----GHIISDGGCSCPGDVAKAFGAGAD
2e77B           SGIWVSNHGARQ--------LYEAPGSFDTLPAIAERV-----NKRVPIVFDSGVRRGEHVAKALASGAD
2bznA           GADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGH----IISDGGCSCPGDVAKAFGAGAD
2bznD           DIIKVGIGPGSVCTTRKKT--GVGYPQLSAVMECADAA----HGLKGHIISDGGCSCPGDVAKAFGAGAD
2drhB           ----------------------------------------------------------------------
2c6qA           DIIKVGIGPGSVCTTRKKT--GVGYPQLSAVMECADAA----HGLKGHIISDGGCSCPGDVAKAFGAGAD
1eepB           DCLKVGIGPGSICTTR--IVAGVGVPQITAICDVYEACN----NTNICIIADGGIRFSGDVVKAIAAGAD
2du2A           SGIWV-------------SNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGAD
2c6qG           DIIKVGIGPGSVCTTR--KKTGVGYPQLSAVMECADAA----HGLKGHIISDGGCSCPGDVAKAFGAGAD
1eepA           DCLKVGIGPGSICTTRIVAGVGVPQITAI--CDVYEACNNTNICII----ADGGIRFSGDVVKAIAAGAD
2e77C           SGIWV-------------SNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGAD
2bznB           DIIKVGIGPGSVCTTRKK--TGVGYPQLSAVMECADAAHGLKGH----IISDGGCSCPGDVAKAFGAGAD
3bw2A           DAV-------------------------------------------------------------------
2bznC           DIIKVGIGPGSVCTTRKK--TGVGYPQLSAVMECADAAHGLKGH----IISDGGCSCPGDVAKAFGAGAD
2cu0B           DAVKVGIGPGSICTTRIVA--GVGVPQITAVAMVADRA----QEYGLYVIADGGIRYSGDIVKAIAAGAD
2a4aB           DFIKTSTGKV--------QINATPSSVEYIIKAIKEYINNPEKNNKIGLKVSGGISDLNTASHYILLARF
2e77A           SGIWV-------------SNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGAD
2a4aA           DFIKTSTGKV--------QINATPSSVEYIIKAIKEYINNPEKNNKIGLKVSGGISDLNTASHYILLARR
2cu0A           DAVKVGIGPGSICTTR--IVAGVGVPQITAVAMVADRAQEYG----LYVIADGGIRYSGDIVKAIAAGAD
3bm5B           GMEIIESTSGNTGIALCQAGAVFGYRVNIAMPSTMSVQMIMKAFGAELILTEGKKGMPGAIEEVNKMIKE
1ak5A           DFIK--------------IGIGRGQATAVIDVVAERNKYFEETGIYIPVCSDGGIVYDYHMTLALAMGAD
1d3gA           DGLIVTNTTVSRPAGLQGALRSETGGLSGDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS
2c6qB           GADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLK----GHIISDGGCSCPGDVAKAFGAGAD
3eisB           AVVSLMGTSLSFYRGAAFNAALTVAMRTTMSTAVLNGLRALGVRRVALATAYIDNERLAAFLAEESLVPT
3c61A           TESVVIKPKQGFGGLGGRYVLPTALANVNAFYRRC---------PGKLIFGCGGVYTGEDAFLHVLAGAS
3bw3A           ----------------------------------------------------------------------
2droA           EYAYYDGTPNDEKGYGHFFSCSYRVAANIGLEWFGGSEWSAEEINKIQAFFADKEPEDYRRYKIDGEPFE
1al7A           ARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEVVKA----AQGRIPVFLDGGVRRGTDVFKALALGAA
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           FPLVKFVTCVNSVGNGLVVIKPKQGFGGLGGKYILPTAAFYRRCPDKLVFGCGGVYSGEDAFLHILAGAS
1d6sA           GVELVEPTNGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKAANLVLTEGAKGMKGAIQKAEEIVAS
3b9tA           ----------------------------------------------------------------------
2b4gB           TVVIKPKQGFG---------GLGGKYVLPTALANVNAFFRR--CPDKLVFGCGGVYSGEEAFLHILAGAS
1d3hA           DGLIVTNTTVSRPAGLQGALRSETGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS
1b3oA           DAL-------------------RVGMGSRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGAS
1ea0A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           SFEFGTTALMMLKCVMAKNCNIKCPAGLTTNQEAFNGDPRALAQYLMNIAHETREILAGLGLRSLREARG
1ea0A           ----------------------------------------------------------------------
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ------------------------------------GKKTAGEQENWHEGKENIRAAVAAGCRQIQDLEI
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           VINMTTVPEVV----LAKEAGICYASIAMATDYD---CWAVSVDRVLKTLKENANKAKSLLLTTIPQSTE
2a7rA           FVMLGGMLAGHSESGGELIERYKLFYGMSSEMTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSR
1ao0A           ----------------------------------------------------------------------
2bwgA           FVMLGGMFSGHTECAGEVIERLKLFYGMSSDTAMNKHYKGDVENTILDILGGLRSTCTYVGAAKLKELSR
2bleA           FVMLGGMFSGHTECAGEVIRKLKLFYGMSSGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSR
2a7rC           FVMLGGMLAGHSESGGELIERYKLFYGMSSEMAMKVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSR
2a7rD           FVMLGGMLAGHSESGGELIERDGKKYKLFYGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSR
1b3oB           TVMMGSLLAATTEAPG----------------EDKGSIHKFVPYL----IAGIQHSCQDIGAKSLTQVRA
2bwgB           FVMLGGMFSGHTECAGEVIRKYGMSSDTAMNKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSR
2bh1A           DLILTSVE---------------IPPGASR------QLENMLPYL---LEDEIAQDVEDVHFCVLSKGRE
2bwgD           FVMLGGMFSGHTECAGEVIRKLKLFYGMSSDTAMNKHAEYRASEGKLDILGGLRSTCTYVGAAKLKELSR
2a1yA           MVMIGSLFAGHEESPGETIEKLKEYFGSFVE------HKGSLEDTLIEMEQDLQSSISYAGGTKLDS-IR
2a7rB           FVMLGGMLAGHSESGGELIERYKLFYGMSSEMAMKKYFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSR
2e77B           VVALGRPVLFGLAL----------------------GGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKG
2bznA           FVMLGGMLAGHSESGGELIERYKLFYGMSSEMAMEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSR
2bznD           FVMLGGMLAGHSESGGELIERYKLFYGMSSEMAMEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSR
2drhB           ----------------------------------------------------------------------
2c6qA           FVMLGGMLAGHSESGGELIERGGVAEYRASEGKTVEVPFKDVEHTIRDILGGIRSTCTYVGAAKLKELSR
1eepB           SVMIGNLFAGTKESPSE----EIIYNGKKFKSYGMVPYSGKLKDILTQLKGGLMSGMGYLGAATISDLKI
2du2A           VVALGRPVLFGLAL----------------------GGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKG
2c6qG           FVMLGGMLAGHSESGGELIEKYKLFYGMSSEMAMKKPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSR
1eepA           SVMIGNLFAGTKESPSEEIIYNKKFKS-------MVPYSGKLKDILTQLKGGLMSGMGYLGAATISDLKI
2e77C           VVALGRPVLFGLAL----------------------GGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKG
2bznB           FVMLGGMLAGHSESGGELIEKYKLFYGMSSEMAMKKPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSR
3bw2A           ----------------------------------------------------------------------
2bznC           FVMLGGMLAGHSESGGELIERYKLFYGMSSEMAMEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSR
2cu0B           AVMLGNLLAGTKEAPGKEVIINGGSLGAMMGVEGVVPYRGTVSEVLYQLVGGLKAGMGYVGARNIRELKE
2a4aB           LFRIGSSSL-------------------------------------------------------------
2e77A           VVALGRPVLFGLAL----------------------GGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKG
2a4aA           FLSDNFRIGSSSLVIKLRKV--------------------------------------------------
2cu0A           AVMLGNLLAGTKEAPGKEVIINGRRKFVPEGVEGVVPYRGTVSEVLYQLVGGLKAGMGYVGARNIRELKE
3bm5B           NPG-------------------------------------------------------------------
1ak5A           FIMLGRYFARFEESPTRKVTIMKEYWGEGSSRGVDSYVPYALKDNVEASLNKVKSTMCNCGALTIPQLQS
1d3gA           LVQLYTALTFWGPPVVGK------------------------------VKRELEALLKEQGFGGVTDAIG
2c6qB           FVMLGGMLAGHSESGGELIERYKLFYGMSSEMAMKKYAGGVAEHTIRDILGGIRSTCTYVGAAKLKELSR
3eisB           GRSLGITGVEAMARVDTATLV-------------------------------------------------
3c61A           MVQVGTALHEEGPAIFER------------------------------LTAELLDVMAKKGYQTLDEFRG
3bw3A           ----------------------------------------------------------------------
2droA           EKSLHPVGLIANAMGSLASVDGPYAKANVDLFWNTPVRTGN-----RRYYDNCLYLFAML----------
1al7A           GVFIGRPVVFSLAA----------------------EGEAGVKKVLQMMRDEFELTMALSGCRSLKEIS-
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           MVQVGTALQEEGPGIFTR------------------------------LEDELLEIMARKGYRTLEEFRG
1d6sA           DPQKYLLLQQFSNPAN------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           MVQVGTALHDEGPIIFARLN------------------------------KELQEIMTNKGYKTLDEFRG
1d3hA           LVQLYTALTF--------------------------WGPPVVGK----VKRELEALLKEQGFGGVTDAIG
1b3oA           TVMMGS--------------------LLAATTEAPGEDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRA
1ea0A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           RSDLLHLLDHPASVGQLDLRAMLAVVEEVKIDNPVYMEKDFALDDAFIELVRSALVDSRRENIELGGNRF
1ea0A           ----------------------------------------------------------------------
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           PSVEVDPCGDAQAAA-EGAVLGLYEYDDLKQKRKV-VVSAKLHGSEDQEAWQRGVL--FASGQNLARRLM
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ---------------------------------------------------HRQSASEADE-IRRIEQVQ
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           WSETLHNLKN------------------------------------------------------------
2a7rA           RTTFI-----------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
2bwgA           RATFI-----------------------------------------------------------------
2bleA           RATFI-----------------------------------------------------------------
2a7rC           RTTFI-----------------------------------------------------------------
2a7rD           RTTFI-----------------------------------------------------------------
1b3oB           MMYSG-----------------------------------------------------------------
2bwgB           RATFI-----------------------------------------------------------------
2bh1A           TADVVGVDRLWLRACLDHLKACG--FDVKRVLPDVLAIPRPEHGLAALQLGDEWLVRKSTTQGMAVDAQW
2bwgD           RATFI-----------------------------------------------------------------
2a1yA           TVDYV-----------------------------------------------------------------
2a7rB           RTTFI-----------------------------------------------------------------
2e77B           L---------------------------------------------------------------------
2bznA           RTTFI-----------------------------------------------------------------
2bznD           RTTFI-----------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           RTTFI-----------------------------------------------------------------
1eepB           NSKFV-----------------------------------------------------------------
2du2A           L---------------------------------------------------------------------
2c6qG           RTTFI-----------------------------------------------------------------
1eepA           NSKFV-----------------------------------------------------------------
2e77C           L---------------------------------------------------------------------
2bznB           RTTFI-----------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           RTTFI-----------------------------------------------------------------
2cu0B           KGEFVIITHAGIKESHPH----------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           L---------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           KGEFVIITHAGIKESHPH----------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           KAKIT-----------------------------------------------------------------
1d3gA           ADH-------------------------------------------------------------------
2c6qB           RTTFI-----------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           KVRTL-----------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           RSHIAADWD-------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           RVKTI-----------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           RVKTM-----------------------------------------------------------------
1d3hA           AD--------------------------------------------------------------------
1b3oA           MMYSG-----------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           LNNCNKSVGGQLAVDIERMLNHELSDEQLDALPAVKRDSRGRRFLEAGSVRIDTSGSAGQSFGAFCNDGM
1ea0A           ----------------------------------------------------------------------
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ETPANEMTPTKFAEIVEENL--------------------KSASIKTDVFIRPKSWIEEQEMGSFLSVAK
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           LPRIAAFIEAGEPIEFVLAFPAKSPN-------PGKV--LDSRPDMAERLSLSFLNHLCQRIQLFYAPGA
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           LS----------LLAASDWVQNEGEYLPLQALTPLPELSLTQEWRYEPVMQLLTQEALTSKFNL------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------DSRPDMAERLSLSFLNHLCQRIQLFYAPGA
3e59B           --------------------------------------------DMAERLSLSFLNHLCQRIQLFYAPGA
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           IMVHTGTCNDGVGKSACGGTIVVRSPGGGSKETGGNVLVGNFALFGATGGRTFVEGQAGDRFAVRNSGAT
1ea0A           ----------------------------------------------------------------------
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           GSEESPNASEPVGKGITFDS------GGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLA
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           KITVCSDGRVFGDLVRIGDAHISAYQLMIEEIGATHIGVFNLEDVRAFEAQRDNHEQLRQLLIGGYAPLE
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           -------------------------------------------------GVTAILPHEGNIYKEKVLAGA
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           KITVCSDGRVFGDLVRIGDAHISAYQDALRIEEIGATHIGVFNLEDVRAFEAQLIGGYAEPLESIRETLL
3e59B           KITVCSDGRVFGDLVRIGDAHISAYQLMIEEIGATHIGVFNQRDNHEQLRQLLIGG-YAEPLESIRETLL
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           AVVEGVGDFACEYMTNGAVXXXXXXXXXXXXXXXXXFVYQYDPYGDLPKKVSHDSILLGSITGEDEQAAI
1ea0A           ----------------------------------------------------------------------
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           PLCENMPS-GKANKPNGKTIQVDNTDAEGRLILADALCYAHTFNPKV-------IINAATLTGAMDIALG
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           SIRETLLASEEGLLLYRAITRFLYEDGLTPDYQGSKTALQRDAKERAYGVIQRSWAWGALLADQFP----
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           FVMNGYSKIQLWELGTIETPIILTNTLSIGTAVEGLLDYILEENEDIGVTTGSVNPLVLEC----NDSYL
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ASEEGLLLYRAITRFL------------------------------------------------------
3e59B           ASEEGLLLYRA-----------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           HNQAVHQLLTLHVAETGSAKAAWLLENWESEQHNFAYGMPRAxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ea0A           ----------------------------------------------------------------------
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           SGAT-------GVFTNSSWLWNKLFEASIETGDRV-----------------------------------
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ---RAIRLSIHPQPADSLKFGIHMMPTRDDWLTPWHGVAVNT----------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           NDIRGRHVKREHVVEAIRADEDFEEGAVGAGTGMSAFEFKG-----------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ea0A           ----------------------------------------------------------------------
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ea0A           ----------------------------------------------------------------------
1ecfB           ----------------------------------------------------------------------
1ecbC           ----------------------------------------------------------------------
1bllE           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------
1eccA           ----------------------------------------------------------------------
3e59A           ----------------------------------------------------------------------
1ecbB           ----------------------------------------------------------------------
2bggB           ----------------------------------------------------------------------
1ecbD           ----------------------------------------------------------------------
1ecbA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
1cb0A           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
1ao0A           ----------------------------------------------------------------------
2bwgA           ----------------------------------------------------------------------
2bleA           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
2bwgB           ----------------------------------------------------------------------
2bh1A           ----------------------------------------------------------------------
2bwgD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
2e77B           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
2drhB           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
3bw2A           ----------------------------------------------------------------------
2bznC           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a4aB           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
2a4aA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
3bm5B           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2c6qB           ----------------------------------------------------------------------
3eisB           ----------------------------------------------------------------------
3c61A           ----------------------------------------------------------------------
3bw3A           ----------------------------------------------------------------------
2droA           ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
3e59D           ----------------------------------------------------------------------
3e59B           ----------------------------------------------------------------------
2e68A           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------
2b4gB           ----------------------------------------------------------------------
1d3hA           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
1ea0A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ea0A           --------------------------------
1ecfB           --------------------------------
1ecbC           --------------------------------
1bllE           --------------------------------
2bplA           --------------------------------
1eccA           --------------------------------
3e59A           --------------------------------
1ecbB           --------------------------------
2bggB           --------------------------------
1ecbD           --------------------------------
1ecbA           --------------------------------
3b9tD           --------------------------------
1cb0A           --------------------------------
2a7rA           --------------------------------
1ao0A           --------------------------------
2bwgA           --------------------------------
2bleA           --------------------------------
2a7rC           --------------------------------
2a7rD           --------------------------------
1b3oB           --------------------------------
2bwgB           --------------------------------
2bh1A           --------------------------------
2bwgD           --------------------------------
2a1yA           --------------------------------
2a7rB           --------------------------------
2e77B           --------------------------------
2bznA           --------------------------------
2bznD           --------------------------------
2drhB           --------------------------------
2c6qA           --------------------------------
1eepB           --------------------------------
2du2A           --------------------------------
2c6qG           --------------------------------
1eepA           --------------------------------
2e77C           --------------------------------
2bznB           --------------------------------
3bw2A           --------------------------------
2bznC           --------------------------------
2cu0B           --------------------------------
2a4aB           --------------------------------
2e77A           --------------------------------
2a4aA           --------------------------------
2cu0A           --------------------------------
3bm5B           --------------------------------
1ak5A           --------------------------------
1d3gA           --------------------------------
2c6qB           --------------------------------
3eisB           --------------------------------
3c61A           --------------------------------
3bw3A           --------------------------------
2droA           --------------------------------
1al7A           --------------------------------
3e59D           --------------------------------
3e59B           --------------------------------
2e68A           --------------------------------
1d6sA           --------------------------------
3b9tA           --------------------------------
2b4gB           --------------------------------
1d3hA           --------------------------------
1b3oA           --------------------------------
1ea0A           --------------------------------