[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK86001.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1cmxA.bssp"
#ERROR : Can't open dsspfile "2dewX.bssp"
#ERROR : Can't open dsspfile "2dw5A.bssp"

## Summary of PDB Search
:153
    6e-05  12%  1cmxA  [d.3.1] PROTEIN (UBIQUITIN YUH1-UBAL)
    2e-04  29%  2dewX  [x.x.x] PROTEIN-ARGININE DEIMINASE TYPE IV
    3e-04  29%  2dw5A  [x.x.x] PROTEIN-ARGININE DEIMINASE TYPE-4
:153

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxVQELETVWSRQDASPQTENVRGPETGLVMVKGRIGGGGAPFNLGETT
1cmxA           -----------------------EWAYFDIYSLTEPE-LLAFLPRPVKAIVLL----------FPINDVI
2dewX           ----------------------------------------------------------------------
2dw5A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VTRATVKLASGTVGHAHVLGTGRKKAWYAAVFDALWQESQTRGFIEAELLSPVEKRLSEEKQRKTKETAA
1cmxA           WFKQSVKNACGLYAILHSLSNNQSLLEPGSDLDNFLKSQ-------SDTSSSKNDDVTTDQFLNVIKENV
2dewX           ---------------------------------KLFQEQQNEGHGEALLF----EGIKKKKQQKIKNILS
2dw5A           ---------------------------------KLFQEQQNEGHGEALLF----EGIKKKKQQKIKNILS


                         +         .         .         .         .         *         .:210
query           TRVDFFTMVRGEx
1cmxA           QTFST--------
2dewX           NKREHNSFVERC-
2dw5A           NKREHNSFVERC-