[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK86181.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2c49A.bssp"
#ERROR : Can't open dsspfile "2c49B.bssp"
#ERROR : Can't open dsspfile "2c4eA.bssp"
#ERROR : Can't open dsspfile "2awdA.bssp"
#ERROR : Can't open dsspfile "3b3lA.bssp"
#ERROR : Can't open dsspfile "2dcnA.bssp"
#ERROR : Can't open dsspfile "3cqdA.bssp"
#ERROR : Can't open dsspfile "3cqdB.bssp"
#ERROR : Can't open dsspfile "2awdB.bssp"
#ERROR : Can't open dsspfile "2abqA.bssp"
#ERROR : Can't open dsspfile "1dgyA.bssp"
#ERROR : Can't open dsspfile "2ajrA.bssp"
#ERROR : Can't open dsspfile "2afbB.bssp"
#ERROR : Can't open dsspfile "3bf5B.bssp"
#ERROR : Can't open dsspfile "1dgmA.bssp"
#ERROR : Can't open dsspfile "2afbA.bssp"
#ERROR : Can't open dsspfile "1dh2A.bssp"
#ERROR : Can't open dsspfile "1dh1A.bssp"
#ERROR : Can't open dsspfile "2absA.bssp"
#ERROR : Can't open dsspfile "1bx4A.bssp"
#ERROR : Can't open dsspfile "2a9yA.bssp"
#ERROR : Can't open dsspfile "3bf5A.bssp"
#ERROR : Can't open dsspfile "2ddoA.bssp"
#ERROR : Can't open dsspfile "1c3qA.bssp"
#ERROR : Can't open dsspfile "2ddoB.bssp"
#ERROR : Can't open dsspfile "2ajpA.bssp"
#ERROR : Can't open dsspfile "2ddmA.bssp"
#ERROR : Can't open dsspfile "2ddmB.bssp"
#ERROR : Can't open dsspfile "2ajpB.bssp"
#ERROR : Can't open dsspfile "2ddwB.bssp"
#ERROR : Can't open dsspfile "2ax3A.bssp"
#ERROR : Can't open dsspfile "1ekqB.bssp"
#ERROR : Can't open dsspfile "1ekqA.bssp"
#ERROR : Can't open dsspfile "3bgkA.bssp"
#ERROR : Can't open dsspfile "1ekkA.bssp"
#ERROR : Can't open dsspfile "3efyB.bssp"
#ERROR : Can't open dsspfile "1d5mC.bssp"
#ERROR : Can't open dsspfile "3efyA.bssp"

## Summary of PDB Search
:299
    7e-42  17%  2c49A  [x.x.x] SUGAR KINASE MJ0406
    9e-41  17%  2c49B  [x.x.x] SUGAR KINASE MJ0406
    4e-40  17%  2c4eA  [x.x.x] SUGAR KINASE MJ0406
    6e-40  15%  2awdA  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    3e-39  19%  3b3lA  [x.x.x] KETOHEXOKINASE
    7e-39  23%  2dcnA  [x.x.x] HYPOTHETICAL FRUCTOKINASE
    8e-39  15%  3cqdA  [x.x.x] 6-PHOSPHOFRUCTOKINASE ISOZYME 2
    1e-38  17%  3cqdB  [x.x.x] 6-PHOSPHOFRUCTOKINASE ISOZYME 2
    6e-38  16%  2awdB  [x.x.x] TAGATOSE-6-PHOSPHATE KINASE
    6e-37  19%  2abqA  [x.x.x] FRUCTOSE 1-PHOSPHATE KINASE
    2e-35  18%  1dgyA  [x.x.x] ADENOSINE KINASE
    2e-35  14%  2ajrA  [x.x.x] SUGAR KINASE, PFKB FAMILY
    3e-35  20%  2afbB  [x.x.x] 2-KETO-3-DEOXYGLUCONATE KINASE
    6e-35  18%  3bf5B  [x.x.x] RIBOKINASE RELATED PROTEIN
    2e-34  18%  1dgmA  [c.72.1] ADENOSINE KINASE
    3e-34  20%  2afbA  [x.x.x] 2-KETO-3-DEOXYGLUCONATE KINASE
    6e-34  18%  1dh2A  [x.x.x] ADENOSINE KINASE APO FORM
    2e-33  18%  1dh1A  [x.x.x] ADENOSINE KINASE
    7e-33  19%  2absA  [x.x.x] ADENOSINE KINASE
    9e-33  20%  1bx4A  [c.72.1] PROTEIN (ADENOSINE KINASE)
    1e-31  17%  2a9yA  [x.x.x] ADENOSINE KINASE
    1e-24  18%  3bf5A  [x.x.x] RIBOKINASE RELATED PROTEIN
    2e-24  16%  2ddoA  [x.x.x] PYRIDOXINE KINASE
    3e-24  10%  1c3qA  [c.72.1] PROTEIN (HYDROXYETHYLTHIAZOLE KINASE)
    2e-22  18%  2ddoB  [x.x.x] PYRIDOXINE KINASE
    4e-22  16%  2ajpA  [x.x.x] PYRIDOXAL KINASE
    4e-17  18%  2ddmA  [x.x.x] PYRIDOXINE KINASE
    7e-15  16%  2ddmB  [x.x.x] PYRIDOXINE KINASE
    6e-14  16%  2ajpB  [x.x.x] PYRIDOXAL KINASE
    8e-14  26%  2ddwB  [x.x.x] PYRIDOXINE KINASE
    5e-12  13%  2ax3A  [x.x.x] HYPOTHETICAL PROTEIN TM0922
    1e-10  16%  1ekqB  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    1e-10  17%  1ekqA  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    6e-10  16%  3bgkA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-09  11%  1ekkA  [c.72.1] HYDROXYETHYLTHIAZOLE KINASE
    8e-07  14%  3efyB  [x.x.x] CIF (CELL CYCLE INHIBITING FACTOR)
    1e-05   5%  1d5mC  [b.40.2 - d.15.6] ENTEROTOXIN TYPE B
    0.001  11%  3efyA  [x.x.x] CIF (CELL CYCLE INHIBITING FACTOR)
:299

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MITVFGSINMDLVATAKRLPKPGETVTGDTFSTAAGGKGANQALAARRAGVTVKMAGATGDDTFAAPALT
2c49A           -ITCVGHTALDYIFNVEKFPEPNTSIQIPSARKYYGGAAANTAVGIKKLGVNSELLSCVGYDFKNSGYER
2c49B           -ITCVGHTALDYIFNVEKFPEPNTSIQIPSARKYYGGAAANTAVGIKKLGVNSELLSCVGYDFKNSGYER
2c4eA           -ITCVGHTALDYIFNVEKFPEPNTSIQIPSARKYYGGAAANTAVGIKKLGVNSELLSCVGYDFKNSGYER
2awdA           LIVTVTNPSIDISYLLDHLK-LDTVNRTSQVTKTPGGKGLNVTRVIHDLGGDVIATGVLGGF-HGAFIAN
3b3lA           -ILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFLVA
2dcnA           -LITLGEILIEFNA-----LSPGPLRHVSYFEKHVAGSEANYCVAFIKQGNECGIIAKVGDDEFGYNAIE
3cqdA           -YTLTLAPSLDSATITPQIYPEGKLRCTA-PVFEPGGGGINVARAIAHLGGSATAIFPAGGA-TGEHLVS
3cqdB           -YTLTLAPSLDSATITPQIY-PEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGA-TGEHLVS
2awdB           LIVTVTNPSIDISYLLDHLK-LDTVNRTSQVTKTPGGKGLNVTRVIHDLGGDVIATGVLGGF-HGAFIAN
2abqA           -YTVTLNPSIDYIVQVENFQ-QGVVNRSERDRKQPGGKGINVSRVLKRLGHETKALGFLGGF-TGAYVRN
1dgyA           FLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKLLRKAGYMGAIGDDPRGQVLKE
2ajrA           -LTVTLNPALDREIFIEDFVNRLYRINDLSKTQSPGGKGINVSIALSKLGVPSVATGFVGGYGKILVEEL
2afbB           -VVTFGEILRLSP------PDHKRIFQTDSFDVTYGGAEANVAAFLAQGLDAY-FVTKLPNNPLGDAAAG
3bf5B           -LAYFGHLNIDVLISVDSIPREGSVNVKD-LRPRFGGTAGNFAIVAQKFRIPFDLYSAVGKTHREY----
1dgmA           -VFAIGNPILDLVAEVPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKLLRKPGSMGAIGDDPRGQVLKE
2afbA           -VVTFGEILRLSP------PDHKRIFQTDSFDVTYGGAEANVAAFLAQGL-DAYFVTKLPNNPLGDAAAG
1dh2A           FLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKLLRKPGYMGAIGDDPRGQVLKE
1dh1A           FLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKLLRKPGYMGAIGDDPRGQVLKE
2absA           -VFAIGNPILDLVAEVPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKLLRKPGYMGAIGDDPRGQVLKE
1bx4A           --------NDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMHKAATFFGCIGIDKFGEILKR
2a9yA           FLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKLLGSAGYMGAIGDDPRGQVLKE
3bf5A           -LAYFGHLNIDVLISVDSIPREGSVNVKD-LRPRFGGTAGNFAIVAQKFRIPFDLYSAVGKTHREYL---
2ddoA           -------------------------------QVVYGSVGNSIAVPAKQNGLNVFAVPTVLLSNTPHYDTF
1c3qA           ------------------------------------------------------------GSMDAQSAAK
2ddoB           ---------------------------------NDKSRALQADIVAVQSQV---VYGSVGNSIAVP----
2ajpA           -------------------------------HVIRGYVGNRAATFPQVLGFEIDAVNSVQFSNHTG----
2ddmA           -----------------------------------GSVGNSIAVPAKQNGLNVFAVPTVLLSNTPHYDTF
2ddmB           -------------------------------LFNDKSRALQADIVAVQSQVVYGSVGNS-----IAVPAI
2ajpB           -------------------------------HVIRGYVGNRAATFPQVLGFEIDAVNSVQFSNHTG----
2ddwB           ----------------------------------------------------------------------
2ax3A           ----------------------------------------------------GKVLIIAGSRLYSGAPVL
1ekqB           ----------------------------------------------------------------------
1ekqA           ----------------------------------------------------------------------
3bgkA           -----------------------------------------------------------GNYPYGGAIIA
1ekkA           ----------------------------------------------------------------------
3efyB           -------------------------------------------------TANAIMKLFLDKDGFSYCFEN
1d5mC           ---------------------------------------SQPDPKPDELHKSSKFTGLMENNHVSAINVK
3efyA           -----------------------------------------------GVTANAIMKLFLDKDGFSYCFEQ


                         .         .         *         .         .         .         .:140
query           LLRDAGTDLSLVKTAPGPTGTAVILIGEGGENMISVIPAANGEVSAFDATKVVGEMDAGDILMLQFEIPX
2c49A           YLKNLDINISKLYYSEEETPKAWIFTDKDNNQITFFLWGAAKHY--KELNPPNFNTEIVHIATGDPEFNL
2c49B           YLKNLDINISKLYYSEEETPKAWIFTDKDNNQITFFLWGAAKHY--KELNPPNFNTEIVHIATGDPEFNL
2c4eA           YLKNLDINISKLYYSEEETPKAWIFTDKDNNQITFFLWGAAKHYKELNPPNFNTEIVHIAT--GDPEFNL
2awdA           ELKKANIPQAFTSIKEETDSIAILHEGNQTEILEAGPTVSPEEISNFLDQLIKQAEIVTISGSLAKGLPS
3b3lA           DFRRRGVDVSQVAWQSKTPSSCCIINNSNGNRTIVLHDTSLPDVATDFEKVDLTQFKWGRNASEQVKMLQ
2dcnA           WLRGQGVDVSHMKIDPSPTGIFFIQRHYPSESIYYRKGSAGSKLSPEDVDEYVKSADLSGITLAISSTAK
3cqdA           LLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGVKL
3cqdB           LLADENVPVATVEAKDWTQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGGVKL
2awdB           ELKKANIPQAFTSIKEERDSIAILHEGNQTEILEAGPTVSPEEISNFLENFDQLIKQAEIVTILAKGLPS
2abqA           ALEKEEIGLSFIEVEGDTRINVKIKGKQETELNGTAPLIKKEHVQALLEQLTELEKGDVLVLAGSVPQAP
1dgyA           LCDKEGLATRFMVAPGQSTGTCAVLINEKERTLCTHLGACGSFRIPENWTTFASGALIFYATATLTATPK
2ajrA           RKISKLITTNFVYVEGETRENIEIIDEKNKTITAINFPGPDVTDDVNHFLRRYKTLSKVDCVVISGSIPE
2afbB           HLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHSAIDWEKILDGARWFHFSGITPPLGKELP
3bf5B           LAIESGINTGHVEKFEDES-GPICYIATDGKKQVSFHQGAAAWAPQLADEYEYVHFSTGPNYLDAKS---
1dgmA           LCDKEGLATRFMVAPGQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFASGALIFYATATLTATPK
2afbA           HLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHEDFDWEKILDGARWFHFSGITPPLGKELP
1dh2A           LCDKEGLATRFMVAPGQSTGTCAVLINEKERTLCTHLGACGSFRIPEDWTTFASGALIFYATATLTATPK
1dh1A           LCDKEGLATRFMVAPGQSTGTCAVLINEKERTLCTHLGACGSFRIPENWTTFASGALIFYATYTLTATPK
2absA           LCDKEGLATRFMVAPGQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFASGALFYATAYTLTATPK
1bx4A           KAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCHLDLEKNWMLVEKARVCYIAGFFLTVSP
2a9yA           LCDKEGLATRFMVAPGQSTGVCAVLINEKRTLCTHLGACGSFRLPEDWTTFASGALIFYATAYTLTATPK
3bf5A           -AIESGINTGHVEKFEDESGPICYIATDGKKQVSFHQGAAAWAPQLADEYEYVHFSTGPNYLDAK-----
2ddoA           YGGAIPDEWFS-------GYLRALQERDALRQLRAVTTGYMGTASQIKILA--------EWLTALRKDHP
1c3qA           CLTAVRRHSPLV-----HSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLIGTLSKESV
2ddoB           AIKQNGLNVFAVPTVLLSNTPHYDYGGAIPDEWFSGYLRALQERDALRQLRAVTTGYMGTASQIKILAEW
2ajpA           ----YAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVV-----DIVQELKQQNPRLV
2ddmA           YGGAIPDEWFS-------GYLRALQERDALRQLRAVTTGYMGTASQIKILA--------EWLTALRKDHP
2ddmB           KQNGLNVFAVPTVLLSNTPHYDTFYGGAIPDEWFSGYLRALQERDALRQLRAVTTGYMGTASQIKI----
2ajpB           YAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGD
2ddwB           ----------------------------------------------------------------------
2ax3A           SGGSLKVGTGLV-KLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGN
1ekqB           ----------------------------------------------------------------------
1ekqA           ----------------------------------------------------------------------
3bgkA           ALACVNSGAGLV-TVATHKDNITALHSHLPEAAFDVEKDRLSEQITAADVVLGPGLAEDDLAQTTFDV--
1ekkA           ----------------------------------------------------------------------
3efyB           TLSLEQLQERLSCMPECKSFVLRVNDGALGHAYIVDIPKGENSCRP-AFL-YQSDLGEGVTRKLRFED--
1d5mC           SIDQFLYFDLIYSIKDTLGNYDNVRVEFKNKDLA------------------------------------
3efyA           TLSLEQLQ------------ERLSCMPECKSFVLRVNDGALGHAYIVDIPKGENSCRPAFLYQSDLGEG-


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXKRITTVINTAPLTADGPRLAGLADIVIANETEFELLIGKNGLSSGERESELKALHDRT
2c49A           KCAKKAYGNNLVSFDPGQDLPQYSKEMLLEIIEHTNFLFMNKHEFERA--------SNLLNFEIDDYLER
2c49B           KCAKKAYGNNLVSFDPGQDLPQYSKEMLLEIIEHTNFLFMNKHEFERASN--------LLNFEIDDYLER
2c4eA           KCAKKAYGNNLVSFDPGQDLPQYSKEMLLEIIEHTNFLFMNKHEFERASN--------LLNFEIDDYLER
2awdA           DFYQELVQKAHAQEVKVLLDTSGDSLRQVLQPWKPYLIKPNLEELEGLLGQDFSENPAAVQTALTKPFAG
3b3lA           RIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQ----SAEEALRGLYGRVRK
2dcnA           EAVYKAFEIASNRSFDTNIRLKLWSAEEAKREILKLLLITDTDDSKIILGESD------PDKAAKAFSDY
3cqdA           EKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSG
3cqdB           EKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSG
2awdB           DFYQELVQKAHAQEVKVLLDTSGDSLRQVLGPWKPYLIKPNLEELEGLLGQDFSENPLAVQTALTKPFAG
2abqA           QTIYRSTQIAKERGAFVAVDTSGEALHEVLAA-KPSFIKPNHHELSELVSKPIASIEDAIPHVQRLIGEG
1dgyA           NALEVAGYAHGIPNAIFTLNLSAPFCVEQSLLLHTNILFGNEEEFAHLAKVHNLVAAEKVALSVAAVEGA
2ajrA           GICNELVRLARERGVFVFVEQTPLLERIYEGPEFPNVVKPDRGNHASFLGVDLKTFDDYVKLAEKLAEK-
2afbB           LILEDALKVANEKGVTVSCDLNYRARLWTKEFEYVDVLIANEEDIEKVLGISVEGLDNREAYAEVTRKYN
3bf5B           ------------IRSKIIFDPSQEIHKYSKKFHEISYSIFNDHEYRVFRET--------------GLSSP
1dgmA           NAFEVAGYAHGIPNAIFTLNLSAPFCVEQSLLLHTNILFGNEEEFAHLAKVHNLVTAALRLLTAGQNTGA
2afbA           LILEDALKVANEKGVTVSCDLNYRARLWTIPFEYVDVLIANEEDIEKVLGISVEGLNREAYAKIATRKYN
1dh2A           NALEVAGYAHGIPNAIFTLNLSAPFCVELSLLLHTNILFGNEEEFAHLAKVHNLVAADKTALSTAAVEGA
1dh1A           NALEVAGYAHGIPNAIFTLNLSAPFCVELYLLLHTNILFGNEEEFAHLAKVHNLVAAEKVALSVAAVTGA
2absA           NALEVAGYAHGIPNAIFTLNLSAPFCVMQSLLLHTNILFGNEEEFAHLAKVHNLVNKEHAVETAGQNTSA
1bx4A           ESVLKVAHHASENNRIFTLNLSAYKESLMKVMPYVDILFGNETEAATFAREQGFETKKKTQALPKMNSKR
2a9yA           NALEVAGYAHGIPNAIFTLNLELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAGALRLLTAGQNTSA
3bf5A           -----------SIRSKIIFDPSQ----------EIHKYSKDELKKFHEISYSIFNDHEYRVFRETGLSSP
2ddoA           DLLIMVDPVIGDIDSGIYVKPDLPEAYRQYLLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLLSDT
1c3qA           EAMIIAGKSANEHGVPVILDPVGAGATPFRREVRLAAIRGNAAEIAHTVGVTDWLIKGVDAGEGGGDIIQ
2ddoB           LTALRKDHPDLLPVIGDYVKPDLPEAYRQYLLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLLSDT
2ajpA           YVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMG
2ddmA           DLLIMVDPVIGDIDSGIYVKPDLPEAYRQYLLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLLSDT
2ddmB           LAEWLTALRKDHPDLLIMVDPVIGDIKPDLLLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLLSDT
2ajpB           KWD---------GEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMG
2ddwB           ------------------------------LLPLAQGITPNIFELEILTGKNCRDLDSAIAAAKSLLSDT
2ax3A           NEHVREFVNEFLKEKPAVIDADAINVLDTSVLKEPAVLTPHPGEARLVKKTVG-DVKYNYELAEEFAKEN
1ekqB           ------------------------------REVRLAAIRGNAAEIAHTVGGGD-----IIRLAQQAAQK-
1ekqA           ----------------------TESARDIIREVRLAAIRGNAAEIAHTVGG------DIIRLAQQAAQK-
3bgkA           ------VWQAIEPKQTLIIDGSAINLLAKRKAIWQIILTPHQKEWERLSGLT-IPEQIEAATQTALAHFP
1ekkA           ----------------------TESARDIIREVRLAAIRGNAAEIAHTVGVTDWLIKGVDAGAQQAAQKL
3efyB           ----------------WMTHKALTPILLDDICNYFSCMSQNKTDLEQIAT---LFDIDGNVKMLRKE---
1d5mC           ----------------------------------------------------------------------
3efyA           -------VTRKLRFEDWMTHKALTPILLDDICNYFSCMSQNKTDLEQI---ATLFDIDGNVKMLRK----


                         .         .         .         +         .         .         .:280
query           GQTLIVTLGADGVIAMRNGKVFSASGLKIEPVDTVGAGDTFCGYLAASLDQGMDFEKALKRAAVAGSLAC
2c49A           VDALIVTKGSKGSVIYKDKKIEIPCIKAGKVIDPTGAGDSYRAGFLSAYVKGYDLEKCGLIGAATASFVV
2c49B           VDALIVTKGSKGSVIYKDKKIEIPCIKAGKVIDPTGAGDSYRAGFLSAYVKGYDLEKCGLIGAATASFVV
2c4eA           VDALIVTKGSKGSVIYKDKKIEIPCIKAGKVIDPTGAGDSYRAGFLSAYVKGYDLEKCGLIGAATASFVV
2awdA           IEWIVISLGKDGAIAKHHDQFYRVKIPTIQAKNPVGSGDATIAGLAYGLAKDAPAAELLKWGAAGANAQE
3b3lA           GAVLVCAWAEEGADALDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKC
2dcnA           AEIIVMKLGPKGAIVYYDGKKYYSSGYQVPVEDVTGAGDALGGTFLSLYYKGFEMEKALDYAIVASTLNV
3cqdA           KKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAAT
3cqdB           KKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAAT
2awdB           IEWIVISLGKDGAIAKHHDQFYRVKIPTIQAKNPVGSGDATIAGLAYGLAKDAPAAELLKWGAAGANAQE
2abqA           IESILVSFAGDGALF-ASAEGFHVNVPSGEVRNSVGAGDSVVAGFLAALQEGKSLEDAVPFAVAAGSATA
1dgyA           TKLVVMTRGHNPVIAAEQTADGTVVVHAEKIVDTNGAGDAFVGGFLYGLSQGKTVKQCIMCGNACAQDVI
2ajrA           SQVSVVSYEVKNDIVAREGVWLIRSKEEIDTSHLLGAGDAYVAGVYYFIKHGANFLEAKFGFA-SALAAT
2afbB           FKTVGITLRESISATVENGQPHFSNRYEIHIVDRVGAGDSFAGALIYGS-LGFDSQKKAEFAAAASCLKH
3bf5B           KVTTIVTNGERGSSLFDGKKYDFPA--IPSSGDTVGAGDSFRAGLYLALYNRRSIEKGIYGTIIAHHVID
1dgmA           TKLVVMTRGHNPVIAAEQTADGTVVVAAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVI
2afbA           FKTVGITLRESISATVNNGQPHFSNRYEIHIVDRVGAGDSFAGALIYGS-LGFDSQKKAEFAAAASCLKH
1dh2A           TKLVVMTRGHNPVIAAEQTADGTVVVHAEKIVDTNGAGDAFVGGFLYGLSQGKTVKQCIMCGNACAQDVI
1dh1A           TKLVVMTRGHNPVIAAEQTADGTVVVHAEKIVDTNGAGDAFVGGFLYGLSQGKTVKQCIMCGNACAQDVI
2absA           TKLVVMTRGHNPVIAAEQTADGTVVVAAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVI
1bx4A           QRIVIFTQGRDDTIMATESEVTAFAVLDQDQKDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIII
2a9yA           TKLVVMTRGHNPVIAAEQTADGTVVVHAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVI
3bf5A           KVTTIVTNGERGSSLFDGKKYDFPA--IPSSGDTVGAGDSFRAGLYLALYNRRSIEKGIYGTIIAHHVID
2ddoA           LKWVVVT--SEMQVVVVTADSVNVISHSRVKTDLKGTGDLFCAQLISGLLKGKALTDAVHRAGLRVLEVM
1c3qA           KLNTVIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGCLLTSVVGAFCAVEENPLFAAIAAISSYGVAA
2ddoB           LKWVVVTSASENQEMQVTADSVNVISHSRVKTDLKGTGDLFCAQLISGLLKGKALTDAVHRAGLRVLEVM
2ajpA           PDTVVITSSDLPSPQGSNYLIVLGSQRRKVDAVFVGTGDLFAAMLLAWTHKHPNLKVACEKTVSTLHHVL
2ddmA           LKWVVVTSQEMQVVVVTADSVNVISHSRV-KTDLKGTGDLFCAQLISGLLKGKALTDAVHRAGLRVLEVM
2ddmB           LKWVVVTSASGENQEMQTADSVNVISHSRVKTDLKGTGDLFCAQLISGLLKGKALTDAVHRAGLRVLEVM
2ajpB           PDTVVITSSDLPSPQGSNYMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNLKVACEKTTLHHVLQR
2ddwB           LKWVVVTSASGNVVVVTADSVNVISHSRVKT-DLKGTGDLFCAQLISGLLKGKALTDAVHRAGLRVLEVM
2ax3A           DCVLVLK-SATTIVTDGEKTLFNITG--NTGLSKGGSGDVLTG-IAGFIAQGLSPLEASTVSVYLHGFAA
1ekqB           LNTVIAITGEVDVIADTSHVYTLHN--GHKLLTKVTGAGLLTSVVGAFCAVEENPLFAAIAAGVAAQLAA
1ekqA           LNTVIAITGEVDVIADTSHVYTLHNGHK--LLTKVTGAGLLTSVVGAFCAVEENPLFAAIAAGVAAQLAA
3bgkA           KETILVAKSHQTKIYQGQKIGHIQVG---GPYQATGGGDTLAGIAGFVAQFHTDRFEVAAAAVFLHSYIA
1ekkA           NTVIAITGEVDVIA---DTSHVYTLHNGHKLLTKVTGAGLLTSVVGAFCAVEENPLFAAIAAISSYGVAA
3efyB           ---NIQYQKHDNFSFQLFEYDTDNIEKNIEIIKSLCSGAAA-----------------------------
1d5mC           ----------------------------------------------------------------------
3efyA           --ENIQYQKHDNFSFQLFEYDTDNIEKNIEIIK-------------------------------------


                         .         *         .         .         .         .         +:350
query           TRAGAQPSIPQAAEVDAAL
2c49A           EAKGCQTNLPTWDKVVERL
2c49B           EAKGCQTNLPTWDKVVERL
2c4eA           EAKGCQTNLPTWDKVVERL
2awdA           RTGHDVENVKKHLNIQVVE
3b3lA           GLQGFDGIV----------
2dcnA           MIRGDQENLPTTKDIETFL
3cqdA           LLCSHDDTQKIYAYLS---
3cqdB           LNQGTR--LCSHDDTQKIY
2awdB           RTGHVDV-ENVKKHLNIQV
2abqA           FSDGFC-------------
1dgyA           QHVGFSLS-----------
2ajrA           RRKEKYPDLEAIKKE----
2afbB           TIPGDFVVLS-IEEIEKLA
3bf5B           DGIELNEDLERETEN----
1dgmA           QHVGFSLSFT---------
2afbA           TIPGDFVV-LSIEEIEKLA
1dh2A           QHVGFS-------------
1dh1A           QHVGFSLS-----------
2absA           QHVGFSLS-----------
1bx4A           RRTGCTPEKPD--------
2a9yA           QHVGFSLSFT---------
3bf5A           DGIENFSLNEDLERE----
2ddoA           RYTQQHESDE---------
1c3qA           QLAAQQTADKGPGSFQIEL
2ddoB           RYTQQHESDE---------
2ajpA           QRTIQCAKAQAGEGVRPSP
2ddmA           RYTQQHESDE---------
2ddmB           RYTQQHESDE---------
2ajpB           TIQCAKAQSPMQLEL----
2ddwB           RYTQQHES-----------
2ax3A           ELFEQDERGLTASELLRLI
1ekqB           QQTADKGPGSFQIELLNKL
1ekqA           QQTADKGPGSFQIELLNKL
3bgkA           DQLSKEAYVVLPTRISAEI
1ekkA           QLAAQQTA-----------
3efyB           -------------------
1d5mC           -------------------
3efyA           -------------------