[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK86197.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ap9A.bssp"
#ERROR : Can't open dsspfile "2bufD.bssp"
#ERROR : Can't open dsspfile "2bufC.bssp"
#ERROR : Can't open dsspfile "2bufA.bssp"
#ERROR : Can't open dsspfile "2btyA.bssp"
#ERROR : Can't open dsspfile "2bufB.bssp"
#ERROR : Can't open dsspfile "2bufI.bssp"
#ERROR : Can't open dsspfile "2bufL.bssp"
#ERROR : Can't open dsspfile "2ap9B.bssp"
#ERROR : Can't open dsspfile "2bufG.bssp"
#ERROR : Can't open dsspfile "2ap9E.bssp"
#ERROR : Can't open dsspfile "2bufE.bssp"
#ERROR : Can't open dsspfile "2bufH.bssp"
#ERROR : Can't open dsspfile "2bufJ.bssp"
#ERROR : Can't open dsspfile "2bufK.bssp"
#ERROR : Can't open dsspfile "2bufF.bssp"
#ERROR : Can't open dsspfile "2egxC.bssp"
#ERROR : Can't open dsspfile "3d2pA.bssp"
#ERROR : Can't open dsspfile "1e19A.bssp"
#ERROR : Can't open dsspfile "2egxA.bssp"
#ERROR : Can't open dsspfile "2e9yB.bssp"
#ERROR : Can't open dsspfile "1b7bA.bssp"
#ERROR : Can't open dsspfile "3e59B.bssp"
#ERROR : Can't open dsspfile "3c1nB.bssp"
#ERROR : Can't open dsspfile "2e9yA.bssp"
#ERROR : Can't open dsspfile "3c1nD.bssp"
#ERROR : Can't open dsspfile "3d41A.bssp"
#ERROR : Can't open dsspfile "3c1mD.bssp"
#ERROR : Can't open dsspfile "3ek6B.bssp"
#ERROR : Can't open dsspfile "3ek5A.bssp"
#ERROR : Can't open dsspfile "3ek5B.bssp"
#ERROR : Can't open dsspfile "2bndB.bssp"
#ERROR : Can't open dsspfile "2bneB.bssp"
#ERROR : Can't open dsspfile "3ek5F.bssp"
#ERROR : Can't open dsspfile "3d40A.bssp"
#ERROR : Can't open dsspfile "2bneA.bssp"
#ERROR : Can't open dsspfile "3ek6A.bssp"
#ERROR : Can't open dsspfile "3c1mC.bssp"
#ERROR : Can't open dsspfile "3c1nA.bssp"
#ERROR : Can't open dsspfile "2bndA.bssp"
#ERROR : Can't open dsspfile "2bnfA.bssp"
#ERROR : Can't open dsspfile "2bnfB.bssp"
#ERROR : Can't open dsspfile "3e59D.bssp"
#ERROR : Can't open dsspfile "3c1mA.bssp"
#ERROR : Can't open dsspfile "3c1nC.bssp"
#ERROR : Can't open dsspfile "2cdqA.bssp"
#ERROR : Can't open dsspfile "2akoA.bssp"
#ERROR : Can't open dsspfile "2brxB.bssp"
#ERROR : Can't open dsspfile "3e59A.bssp"
#ERROR : Can't open dsspfile "2bmuA.bssp"
#ERROR : Can't open dsspfile "2bmuB.bssp"
#ERROR : Can't open dsspfile "2brxA.bssp"
#ERROR : Can't open dsspfile "2c10B.bssp"
#ERROR : Can't open dsspfile "2c10A.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "2a1fA.bssp"
#ERROR : Can't open dsspfile "2dt8A.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "3bicA.bssp"
#ERROR : Can't open dsspfile "2a1uA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"

## Summary of PDB Search
:294
    5e-59  42%  2ap9A  [x.x.x] ACETYLGLUTAMATE KINASE
    7e-58  47%  2bufD  [x.x.x] ACETYLGLUTAMATE KINASE
    1e-57  47%  2bufC  [x.x.x] ACETYLGLUTAMATE KINASE
    1e-57  48%  2bufA  [x.x.x] ACETYLGLUTAMATE KINASE
    4e-57  53%  2btyA  [x.x.x] ACETYLGLUTAMATE KINASE
    5e-57  47%  2bufB  [x.x.x] ACETYLGLUTAMATE KINASE
    5e-57  48%  2bufI  [x.x.x] ACETYLGLUTAMATE KINASE
    6e-57  48%  2bufL  [x.x.x] ACETYLGLUTAMATE KINASE
    6e-57  41%  2ap9B  [x.x.x] ACETYLGLUTAMATE KINASE
    2e-56  47%  2bufG  [x.x.x] ACETYLGLUTAMATE KINASE
    9e-56  41%  2ap9E  [x.x.x] ACETYLGLUTAMATE KINASE
    7e-55  49%  2bufE  [x.x.x] ACETYLGLUTAMATE KINASE
    2e-54  47%  2bufH  [x.x.x] ACETYLGLUTAMATE KINASE
    6e-54  49%  2bufJ  [x.x.x] ACETYLGLUTAMATE KINASE
    1e-52  49%  2bufK  [x.x.x] ACETYLGLUTAMATE KINASE
    6e-52  48%  2bufF  [x.x.x] ACETYLGLUTAMATE KINASE
    7e-51  32%  2egxC  [x.x.x] PUTATIVE ACETYLGLUTAMATE KINASE
    4e-47  23%  3d2pA  [x.x.x] PUTATIVE ACETYLGLUTAMATE SYNTHASE
    2e-44  20%  1e19A  [c.73.1] CARBAMATE KINASE-LIKE CARBAMOYLPHOSPHATE
    2e-42  34%  2egxA  [x.x.x] PUTATIVE ACETYLGLUTAMATE KINASE
    1e-41  23%  2e9yB  [x.x.x] CARBAMATE KINASE
    3e-41  22%  1b7bA  [c.73.1] CARBAMATE KINASE
    8e-38  11%  3e59B  [x.x.x] PYOVERDINE BIOSYNTHESIS PROTEIN PVCA
    3e-36  20%  3c1nB  [x.x.x] PROBABLE ASPARTOKINASE
    5e-36  22%  2e9yA  [x.x.x] CARBAMATE KINASE
    6e-36  15%  3c1nD  [x.x.x] PROBABLE ASPARTOKINASE
    6e-36  14%  3d41A  [x.x.x] FOMA PROTEIN
    2e-33  20%  3c1mD  [x.x.x] PROBABLE ASPARTOKINASE
    2e-33  17%  3ek6B  [x.x.x] URIDYLATE KINASE
    2e-33  19%  3ek5A  [x.x.x] URIDYLATE KINASE
    2e-32  18%  3ek5B  [x.x.x] URIDYLATE KINASE
    3e-32  16%  2bndB  [x.x.x] URIDYLATE KINASE
    6e-32  17%  2bneB  [x.x.x] URIDYLATE KINASE
    9e-32  19%  3ek5F  [x.x.x] URIDYLATE KINASE
    1e-31  15%  3d40A  [x.x.x] FOMA PROTEIN
    2e-31  14%  2bneA  [x.x.x] URIDYLATE KINASE
    3e-31  18%  3ek6A  [x.x.x] URIDYLATE KINASE
    7e-31  20%  3c1mC  [x.x.x] PROBABLE ASPARTOKINASE
    3e-30  21%  3c1nA  [x.x.x] PROBABLE ASPARTOKINASE
    4e-30  15%  2bndA  [x.x.x] URIDYLATE KINASE
    4e-30  17%  2bnfA  [x.x.x] URIDYLATE KINASE
    7e-30  18%  2bnfB  [x.x.x] URIDYLATE KINASE
    3e-28  11%  3e59D  [x.x.x] PYOVERDINE BIOSYNTHESIS PROTEIN PVCA
    1e-27  20%  3c1mA  [x.x.x] PROBABLE ASPARTOKINASE
    2e-27  18%  3c1nC  [x.x.x] PROBABLE ASPARTOKINASE
    1e-26  17%  2cdqA  [x.x.x] ASPARTOKINASE
    2e-26  18%  2akoA  [x.x.x] GLUTAMATE 5-KINASE
    7e-24  20%  2brxB  [x.x.x] URIDYLATE KINASE
    8e-23  12%  3e59A  [x.x.x] PYOVERDINE BIOSYNTHESIS PROTEIN PVCA
    3e-20  17%  2bmuA  [x.x.x] URIDYLATE KINASE
    1e-19  19%  2bmuB  [x.x.x] URIDYLATE KINASE
    1e-16  17%  2brxA  [x.x.x] URIDYLATE KINASE
    1e-11   8%  2c10B  [x.x.x] MEMBRANE COPPER AMINE OXIDASE
    9e-11  10%  2c10A  [x.x.x] MEMBRANE COPPER AMINE OXIDASE
    5e-09  20%  2a1fE  [x.x.x] URIDYLATE KINASE
    3e-08  23%  2a1fD  [x.x.x] URIDYLATE KINASE
    1e-07  22%  2a1fA  [x.x.x] URIDYLATE KINASE
    4e-07  17%  2dt8A  [x.x.x] DEGV FAMILY PROTEIN
    3e-05  16%  2a1fF  [x.x.x] URIDYLATE KINASE
    1e-04  33%  3bicA  [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
    4e-04  30%  2a1uA  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN ALPHA-SUBUNIT,
    7e-04  13%  2a1fC  [x.x.x] URIDYLATE KINASE
:294

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTSSESEIQARLLAQALPFMQKYENKTIVVKYGGHAMGDSTLGKAFAEDIALLKQSGINPIVVHGGGPQI
2ap9A           ----PTHIKAQVLAEALPWLKQLHGKVVVVKYGGNAT-DDTLRRAFAAD-AFLRNCGIHPVVVHGGGPQI
2bufD           LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufC           LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufA           LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2btyA           --------TVNVLLEALPYIKEFYGKTFVIKFGGSAMKQENAKKAFIQDIILLKYTGIKPIIVHGGGPAI
2bufB           LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufI           LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufL           LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2ap9B           IEALPTHIKAQVLAEALPWLKQLHGKVVVVKYGGNAT-DDTLRRAFAAD-AFLRNCGIHPVVVHGGGPQI
2bufG           LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2ap9E           IEALPTHIKAQVLAEALPWLKQLHGKVVVVKYGGNAT-DDTLRRAFAAD-AFLRNCGIHPVVVHGGGPQI
2bufE           LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufH           LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufJ           LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufK           LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2bufF           LSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQI
2egxC           ---------------------------IVVKVGGAEGIN---YEAVAKDAASLWKEGVKLLLVHGGSAET
3d2pA           ------DSFVAHFREAAPYIRQMRGTTLVAGIDGRLLEGGTL-NKLAADIGLLSQLGIRLVLIHGAYHFL
1e19A           -------------------------KRVVIALGGNALQQRGQKRKTARQIAEIIARGYEVVITHGNGPQV
2egxA           ---------------------------IVVKVGGAEGINY---EAVAKDAASLWKEGVKLLLVHGGSAET
2e9yB           -------------------------RLAVIALGGNAIAGPGMDVSVSSIIADVLADGWRSVITHGNGPQV
1b7bA           -------------------------KKMVVALGGNAILSNDASVQTSAYLVHLIKQGHRLIVSHGNGPQV
3e59B           EADEIRRIEQVQLPRIAAFIEAGEKSPNPGKVLDSRPDMASFLNHLCQRIQLFYAPGAKITVCSDGRVFG
3c1nB           --------------------------TTVMKFGGTSVGSGERIRHVAKIVTKRKKEVTNALVEISQQALD
2e9yA           -------------------------RLAVIALGGNAIAGPGMDVSVSSIIADVLADGWRSVITHGNGPQV
3c1nD           ---KRKKEDVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAISEEIKEEVKKII
3d41A           ---------------LVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDARLAETYRGRMVLISGGGAFG
3c1mD           --------------------------TTVMKFGGTSVGSGERIRHVAKIVTKRKKEVTNALVEISQQALD
3ek6B           -------------------MSELSYRRILLKLSGEALMGDKVINRLAHEVIEAQQAGAQVALVIGGGNIF
3ek5A           -------------------MSELSYRRILLKLSGEALMGDKVINRLAHEVIEAQQAGAQVALVIGGGNIF
3ek5B           -------------------------RRILLKLSGEALMGDKVINRLAHEVIEAQQAGAQVALVIGGGNIF
2bndB           ---------------------KPVYKRILLKLSGEALQGTEFGIDASILDRMAQELGIQVGVVIGGG---
2bneB           --------------------AKPVYKRILLKLSGEALQGTEFGIDASILDRMAQELGIQVGVVIGGG---
3ek5F           -------------------------RRILLKLSGEALMGDKVINRLAHEVIEAQQAGAQVALVIGGGNIF
3d40A           --------------GLVPRGSHMTPDFLAIKVGGSLFSRKDEP--GSLDDDAVTRFARNFARLAETYRGR
2bneA           ---------------------KPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVEL---GIQV
3ek6A           -------------------MSELSYRRILLKLSGEALMGDKVINRLAHEVIEAQQAGAQVALVIGGGNIF
3c1mC           --------------------------TTVMKFGGTSVGSGERIRHVAKIVTKRKKEVTNALVEISQQALD
3c1nA           --------------------------TTVMKFGGTSVGSGERIRHVAKIVTKRKKEVTNALVEAKVGDFI
2bndA           ---------------------KPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVEL---GIQV
2bnfA           ---------------------KPVYKRILLKLSGEALQGTEGFGIDASILDRAQEI----KELVELGIQV
2bnfB           ---------------------KPVYKRILLKLSGEALQG----TEFGIDASILD--RAQEIKLVELGIQV
3e59D           EADEIRRIEQVQLPRIAAFIEAPAKSPNPGKVLDSRPDMAERLSHLCQRIQLFYAPGAKITVCSDGRVFG
3c1mA           --------------------------TTVMKFGGTSVGSGERIRHVAKIVTKRKKSEVTNALVAKVGDFI
3c1nC           --------------------------TTVMKFGGTSVGSGERIRHVAKIVTKRKKETNALVEISQQALDV
2cdqA           -------------------------ITCVMKFGGSSVASAERMKEVADLILTFPE-ESPVIVLSAMGKTT
2akoA           -------------------------KRIVVKVGSHVISEENTLKNLVAFLAKLE--KYEVILVTSAAISA
2brxB           -------------------------MRIVFDIGGSVLVPENPDIDFIKEIALTKVSEDHEVAVVVGGGKL
3e59A           ------------------------KSPNPGKVLDSRPDMAEFLNHLCQRIQLFYAPGAKITVCSDGVRIG
2bmuA           ---------------------------IVFDIGGSVLVPENPDIDFIKEIALTKVSEDHEVAVVVGGGKL
2bmuB           ---------------------------IVFDIGGSVLVPENPDIDFIKEIATKVSEDHEVAVVVGGGKLA
2brxA           -------------------------MRIVFDIGGSVLVPENPDIDFIKEIATKVSEDHEVAVVVGGGKLA
2c10B           ----------------------------------------------------------------------
2c10A           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2a1fA           -------------------LSQPIYKRILLKLSGEAQGEDGLGDRMAVEIKELVEMGVEVSVVLGGGNL-
2dt8A           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3bicA           ----------------------------------HAVGVSTLAAGVPELIKELNSLGRPDILVMCGGVIP
2a1uA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GAMLSKMGIESKFEGGLRVTDAKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAKKT
2ap9A           -TALRRLGIEGDFKGGFRVTTPEVLDVARV-LFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVT
2bufD           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLT--
2bufC           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2bufA           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2btyA           SQMMKDLGIEPVFKNGHRVTDEKTMEIVEMVLVGKINKEIVMNLNLHGGRAVGICGKDSKLIVAEKETKH
2bufB           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2bufI           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKL---
2bufL           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2ap9B           -TALRRLGIEGDFKGGFRVTTPEVLDVARV-LFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVR----
2bufG           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2ap9E           -TALRRLGIEGDFKGGFRVTTPEVLDVARV-LFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVT
2bufE           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2bufH           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2bufJ           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAK-----
2bufK           GDLLKRLSIESH-----RVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKK----
2bufF           GDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDAELIRAKKLTVT
2egxC           NKVAEALGHPPRFLTVSRLTDRKTLEIFEMVYCGLVNKRLVELLQKEGANAIGLSGLDGRLFVGRRKTAV
3d2pA           DRLAAAQGRTPHYCRGLRVTDETSLGQAQQFAGTVRSRFEAALCGSVSGRAPSVPLVSGNFLTARPI--G
1e19A           GSLLLHMD----AGQATYGIPAQPMDVAGAMSQGMIQQALKNELRKRGMEKKVVTIITQTIVDKND--PA
2egxA           NKVAEALGHPPRF--VSRLTDRKTLEIFEMVYCGLVNKRLVELLQKEGANAIGLSGLDGRLFVGR-----
2e9yB           GYLSEAFEALP------PERPRQPLYIATAMTQAWIGLLLKHSLEE----ELRRRGEEAEELSRRYGWVF
1b7bA           GNLLLQQQAAKNPAMPLDTCVAMTQGSIGYWLSNALNQELADEAFKNPTKPIGPFLTEAEAKEAMQAGAI
3e59B           D--LVRIGDAHISAYQDALRLMIEEIGATHIGVFNLEDVRAFEAQRDNHEQLRQLLIGGYAEPLESIRET
3c1nB           VRDIAKIEELEKVLIGVAYLGELTPKSRDYILSERLSSPILGAIRDLGEKSIALEGGEAGIITDN-----
2e9yA           GYLSEAFEALP------PERPRQPLYIATAMTQAWIGLLLKHSLEEELR-RRGL-----NVLVPVVISRV
3c1nD           DSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDN-----
3d41A           HGAIRDHDSTHAFSLAGLTEAT-----------FEVKKRWAEKLRGIGVDAFPLQLAAMCTL--------
3c1mD           VRDIAKIEELEKVLIGVAYLGELTPKSRDYILSRLSSPILSGAIRDLGEKSIALEGGEAGIITDN-----
3ek6B           RGAGLAASGMDRVTG----------DHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDV------CE
3ek5A           RGAGLAASG----------MDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRR
3ek5B           RGA-------GLAASGMDRVTGDHMGMLATVINALA---MQDALEKLGAKVRVMSAIKINDVCEDFIRRR
2bndB           ----NLFRGAGLAKAGMNRVVGDHMGMLATVMNGLA---MRDALHRAYVNARLMSAIP------------
2bneB           ----NLFRGAGLAKAGMNRVVGDHMGMLATVMNGLA---MRDALHRAYVNARLMSA--------------
3ek5F           RGAGLAA----------SGMDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRR
3d40A           MVLISGGGAFAFSLAGL------------TEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTL--------
2bneA           GVVIGLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL--------------------
3ek6A           RGAG-------LAASGMDRVTGDHMGMLATVINALAM---QDALEKLGAKVRVMSAIKINDVCEDFIRRR
3c1mC           VRDIAKIEELEKVLIGVAYLGELTPKSRDYIFGERLSSPILSAIRDLGEKSIALEGGEAGIITDN-----
3c1nA           KFIDSRIEELEKVLIGVAYLGELTPKSRDYILSERLSSPILSAIRDLGEKSIALEGGEAGIITDN-----
2bndA           GVVIGLFRGAGLAKAGMNRVVGDHMGMLATVMNGLA---MRDALHRAYVNARLMSAIP------------
2bnfA           GVVIGG-GNLFRGAGLAKAGNRVVGDHGLATVNGLARDALHRAYVNARLSAIPLNVCDS-----------
2bnfB           GVVIGG-GNLFRGAGLAKAGNRVVGDHGLATVNGLARDALHRAYVNARLSAIPLNVCD--SYSWAE----
3e59D           D--LVRIGDAHISAYQDALRLMIEEIGATHIGVFNLEDVRAFEAQRDEQLRQLLIGGYAEPLESIR----
3c1mA           KFIREKIEELEKVLIGVAYLGELTPKSRDYIFGERLSSPILSAIRDLGEKSIALEGGEAGIITDN-----
3c1nC           RDIAKRIEELEKVLIGVAYLGELTPKSRDYILGERLSSPILSAIRDLGEKSIALEGGEAGIITDN-----
2cdqA           NNLLTYLEELEQLLKGIAMMKELTLRTRDYLVSFGSTRIFAAYLNTIGVKARQYDAFEIGFITTDDFTN-
2akoA           GHTKLDIDRKNLINKQVLAA------IGQPFLISVYN-----------------------ELLAKFNKLG
2brxB           ARKYIEVA----EKFNSSETFKDFIGIQITRANAMLLIAALREKAY----------------------PV
3e59A           DAHISAYQDALRLM----IEEIGATHIGVFNLEDVRAFEAQRDNHEQLRQLLIGGYAEPLESIRETLLAS
2bmuA           ARKYIEVA----EKFNSSETFKDFIGIQITRANALLIAALREKAYPVV----------------------
2bmuB           -----RKYIEVAEKFNSSETFKDFIGIQITRANALLIAALR-----------------------EKAYPV
2brxA           RKYIEVA-----EKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEA--------------
2c10B           ----------------------------------------------------------------------
2c10A           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2a1fA           --------------FRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRADV-----------NAKLM
2dt8A           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3bicA           PQDLFEVGVSNVFGPGTRPKAAVQVDIEKC----------------------------------------
2a1uA           -------------------------------------------VGQTGKIAVGISGAIQHLAGMKDSKTI
2a1fC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VIDPDSNIERVLDLGFVGEVVEVDRTLLDLLAKSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALHAT
2ap9A           VDGVAT------DIGLVGDVDQVNTAALDLVAA-GRIPVVSTLAPDADGVVHNINADTAAAAVAEALGAE
2bufD           --VTRQTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAE
2bufC           RQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAE
2bufA           RQI--------IDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAE
2btyA           G-----------DIGYVGKVKKVNPEILHALIENDYIPVIAPVGIGEDGHSYNINADTAAAEIAKSLMAE
2bufB           RQEMTK--PEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAE
2bufI           -----TVTREIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAE
2bufL           RQKPE-----IIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAE
2ap9B           --RSVTVDGVATDIGLVGDVDQVNTAALDLVAA-GRIPVVSTLAPDADGVVHNINADTAAAAVAEALGAE
2bufG           RQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAE
2ap9E           VDGVAT------DIGLVGDVDQVNTAALDLVAA-GRIPVVSTLAPDADGVVHNINADTAAAAVAEALGAE
2bufE           II----------DIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAE
2bufH           RQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAE
2bufJ           ------------KLGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAE
2bufK           --------------LTVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAE
2bufF           RQP------EIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAE
2egxC           KYVKVK----VHRGDYTGTVEEVNKALLDLLLQAGYLPVLTPPALSYENEAINTDGDQIAALLATLYGAE
3d2pA           VIDGT-------DMEYAGVIRKTDTAALRFQLDAGNIVWMPPLGHSYGGKTFNLDMVQAAASVAVSLQAE
1e19A           FQNPTKPVGPFYDEETAKRLAREKGWIVKEDSGRGWRRVVPLEDGEIKGVEAVIDKDLAGEKLAEEVNAD
2egxA           ------------RKDYTGTVEEVNKALLDLLLQAGYLPVLTPPALSYENEAINTDGDQIAALLATLYGAE
2e9yB           KRDPRGGFRRVVPSPRPVSIVDRD-LIAEASAESPAVVALVPVVERPGGVLEPVEADLASSLLATQLNAD
1b7bA           FKEDAGRGWRK-VVPSPKPIDIHEAETINTLIKNDIITIIPVVGQELKGVEAVIDKDFASEKLAELVDAD
3e59B           LLAS---EEGLLLYRAITRFLYEDGLTPDY------QGSKTALQRDAKERAYGQRSWAWGALLADQFPRA
3c1nB           ------------NFGSARVKRLEVKERLLPLLKEGIIPVVTGFEEGYITTLGRGGSDYSAALIGYGLDAD
2e9yA           LVDVSDPS-FNNPSKPVGPIYGREEAEELSRRYIVDRDLIAEVALGGGGVPVVVDKDLASSLLATQLNAD
3c1nD           ------------NFGSARVKRLEVKERLLPLLKEGIIPVVTGFIEGYITTLGRGGSDYSAALIGYGLDAD
3d41A           ----------------RNGIPQLRSEVLRDVLDHGALPVLADALFDEHGKLWAFSSDRVPEVLLPMVEGR
3c1mD           ------------NFGSARVKRLEVKERLLPLLKEGIIPVVTGFEEGYITTLGRGGSDYSAALIGYGLDAD
3ek6B           DFIRR-RAIRHLEKGRIAIFAA-------------------------GTGNPFFTTDSGAALRAIEIGAD
3ek5A           -------AIRHLEKGR--------------------IAIFAA-----GTGNPFFTTDSGAALRAIEIGAD
3ek5B           -------AIRHLEKGR--------------------IAIFAA-----GTGNPFFTTDSGAALRAIEIGAD
2bndB           ---------------LNAVCDSYSWAEAISLLRNNRVVILSAG-----TGNPFFTTDSAACLRGIEIEAN
2bneB           -------------IPLNGVCDSYSWAEAISLLRNNRVVILSA-----GTGNPFFTTDSAACLRGIEIEAN
3ek5F           -------AIRHLEKGR--------------------IAIFAA-----GTGNPFFTTDSGAALRAIEIGAD
3d40A           ----------------RNGIPQLRSEVLRDVLDHGALPVLADALFDEHGKLWAFSSDRVPEVLLPMVEGR
2bneA           ----------MSAIPLNGVCDSYSWAEAISLLRNNRVVILSAG-----TGNPFFTTDSAACLRGIEIEAN
3ek6A           -------AIRHLEKGR--------------------IAIFAA-----GTGNPFFTTDSGAALRAIEIGAD
3c1mC           ------------NFGSARVKRLEVKERLLPLLKEGIIPVVTGFEEGYITTLGRGGSDYSAALIGYGLDAD
3c1nA           ------------NFGSARVKRLEVKERLLPLLKEGIIPVVTGFIEGYITTLGRGGSDYSAALIGYGLDAD
2bndA           ---------------LNAVCDSYSWAEAISLLRNNRVVILSAGTGNPFF-----TTDSAACLRGIEIEAN
2bnfA           -YSWA-EAISLLRNNRV-------------------------VILSAGTGNPFFTTDSAACLRGIEIEAN
2bnfB           -------AISLLRNNR--------------------VVILSA-----GTGNPFFTTDSAACLRGIEIEAN
3e59D           -ETLLASEEGLLLYRAITRFLYE-----DGLTPDYQGSKTALQRDAKERAYVIQRSWAWGALLADQFPRA
3c1mA           ------------NFGSARVKRLEVKERLLPLLKEGIIPVVTGFIEGYITTLGRGGSDYSAALIGYGLDAD
3c1nC           ------------NFGSARVKRLEVKERLLPLLKEGIIPVVTGFEEGYITTLGRGGSDYSAALIGYGLDAD
2cdqA           ------------GDILEATYPAVAKRLYDDWMHDPAVPIVTGWKTGAVTTLGRGGSDLTATTIGKALGLK
2akoA           GQIL-------LTGKDFDSRKATKHAKNAIDINLGILPIINENDATAIEEIVFGDNDSLSAYATHFFDAD
2brxB           VVEDFWEAWKAVQLKK--------------------IPVMGGTHP-------GHTTDAVAALLAEFLKAD
3e59A           E-------EGLLLYRAITRFLYEDGLTPDYQSKTALQRDAKERAYGVIQ-----RSWAWGALLADQFPRA
2bmuA           -----------------------------VEDFWEAWKAVQLKKIPVGGTHPGHTTDAVAALLAEFLKAD
2bmuB           VVEDFWEAWKAVQLKKIPVGGT----------------------------HPGHTTDAVAALLAEFLKAD
2brxA           -----------------------------------WKAVQLKKIPVMGGTHPGHTTDAVAALLAEFLKAD
2c10B           -------VFSVELQLPPKAAALHLDRGSPPPAREALAIVFF----GRQPQPN-VSELVVGPLPHPSYMRD
2c10A           -----------LQLPPKAAALAHLDRGSPPPAREALAIVFF----GRQPQPN-VSELVVGPLPHPSYMRD
2a1fE           -----------------------------------MLREKRVVIFSAGTGNPFFTTDSTACLRGIEIEAD
2a1fD           --------------------------------------------------------DSTACLRGIEIEAD
2a1fA           SAFQLNGICDTYNW----------SEAIKMLREKR-VVIFSAGTGNPFFTT-----DSTACLRGIEIEAD
2dt8A           ----------------ITLVTDSTSDLPQDLRGRLGVRVV-PLYVNLSGAIYRDWEEITPTEIFQKVREG
2a1fF           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
2a1uA           VKDPEAPIFQVADYGIVADLFKVVPEMTEILKK-------------------------------------
2a1fC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RLLFLTDVPGVLDKNKELIKELTVSEARALIKDGTISGGMIPKVETCIDAIKAGVQGVVILNGKTPHSVL
2ap9A           KLL-LTDIDGLYTRWPDRDSLVSEIDTGTLAQLLPTLELGVPKVEACLRAVIGGVPSAHIIDGRVTHCVL
2bufD           KLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufC           KLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufA           KLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2btyA           KLILLTDVDGVLKDGK-LISTLTPDEAEELIRDGTVTGGMIPKVECAVSAVRGGVGAVHIINGGLEHAIL
2bufB           KLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufI           KLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufL           KLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2ap9B           KLL-LTDIDGLYTRWPDRDSLVSEIDTGTLAQLLPTLELGVPKVEACLRAVIGGVPSAHIIDGRVTHCVL
2bufG           KLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2ap9E           KLL-LTDIDGLYTRWPDRDSLVSEIDTGTLAQLLPTLELGVPKVEACLRAVIGGVPSAHIIDGRVTHCVL
2bufE           KLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufH           KLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufJ           KLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufK           KLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2bufF           KLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVL
2egxC           ALVYLSNVPGLLARYPSLVREIPVERIEDPEYLALAQGRMKRKVMGAVEAVKGGVKRVVFADGRVENPIR
3d2pA           KLVYLTLSDGISRPDGTLAETLSAQEAQSLAEHAASETRRLISSAVA-----------------------
1e19A           IFMILTDVNGAALEKEQWLREVKVEELRKYYEEGHKAGSMGPKVLAAIRFIEWGGERAIIAHLEKAVEAL
2egxA           ALVYLSNVPGLLASLV---REIPVERIEDPEYLALAQGRMKRKVMGAVEAVKGGVKRVVFADGRVENPIR
2e9yB           LLVILTDVPGVAVEGERWLRRAAASELKKYLREGHFPGSMGPKVEAAISFVERTGKPAVIGSLEEARQVL
1b7bA           ALVILTGVDYVCINYGKQLTNVTVAELEEYKQAGHAPGSMLPKIEAAIQFVESQPNKQAII---TSLENL
3e59B           IRLSIHPQPADSLKFGIHMMPTRWLTPWHGVAVNTEDRFVLMKRSEVLELGGEL----VQINGQPSH---
3c1nB           IIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMEYFGAKVLHPRTIEPAMEKGIP-ILVKNTFEPESEG
2e9yA           LLVILTDVPGVAVEGERWLRRAAASELKKYLREGHPPGSMGPKVEAAISFVERTGKPAVIGSLEEARQVL
3c1nD           IIEIWTDVSGVYTTDPRLVPTARRIPKLSYIMELAYFGAKVLHPRTIEPAMEKGIP-ILVKNTFEPESEG
3d41A           LRVVLTDVDGIVTPEVDARSPEQAYAALWGSSEWDATGAMHTKLDALVTCARRGAE-CFIMRGDPGSDLE
3c1mD           IIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMEYFGAKVLHPRTIEPAMEKGI-PILVKNTFEPESEG
3ek6B           LLLKATKVDGVYDKDPKKHSDAVRYD-SLTYDEVIMQGLEVMDTAAFALARDSDLP-LRIFGMSEPGVLL
3ek5A           LLLKATKVDGVYDKDPKKHSDAV-RYDSLTYDEVIMQGLEVMDTAAFALARDSDLP-LRIFGMSEPGVLL
3ek5B           LLLKATKVDGVYDKDPKKHSDAV-RYDSLTYDEVIMQGLEVMDTAAFALARDSDLP-LRIFGMSEPGVLL
2bndB           VVLKATKVDGVFTADPAKDPTATMYE-QLTYSEVLEKELKVMDLAAFTLARDHKLP-IRVFNMNKPGALR
2bneB           VVLKATKVDGVFTADPAKDPTAT-MYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVF-NMNKPGALR
3ek5F           LLLKATKVDGVYDKDPKKHSDAVRYD-SLTYDEVIMQGLEVMDTAAFALARDSDLP-LRIFGMSEPGVLL
3d40A           LRVVLTDVDGIVTDGDTILPEVDARSPEQAYLWGSSEGAMHTKLDALVTCARRGAE-CFIMRGDPGS--D
2bneA           VVLKATKVDGVFTADPPTATMYEQLTYSEVLE----KELKVMDLAAFTLARDHKLP-IRVFNMNKPGALR
3ek6A           LLLKATKVDGVYDKDPKKHSDAVRYD-SLTYDEVIMQGLEVMDTAAFALARDSDLPLRIF-GMSEPGVLL
3c1mC           IIEIWTDVSGVYTTDPRLVPTARRIPKLSYIMELAYFGAKVLHPRTIEPAMEKGI-PILVKNTFEPESEG
3c1nA           IIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMEYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGT
2bndA           VVLKATKVDGVFTADPAKDPTATMYE-QLTYSEVLEKELKVMDLAAFTLARDHKLP-IRVFNMNKPGALR
2bnfA           VVLKATKVDGVFTADP---AKDPTATYEQLTYSEVLEKELKVDLAAFTLARDHKLP-IRVFNNKPGA--L
2bnfB           VVLKATKVDGVFTADPAKDPT---ATYEQLTYSEVLEKELKVDLAAFTLARDHKLP-IRVFNNKPG---A
3e59D           IRLSIHPQPADSLKGIHMMPTRDDWLTPWHGVAVN--TEDRFVLMKRSEVLELGGE-LVQINGQPSHYRL
3c1mA           IIEIWTDVSGVYTTDPRLVPTARRIPKLSYIMELAYFGAKVLHPRTIEPAMEKGIP-ILVKNTFEPESEG
3c1nC           IIEIWTDVSGVYTTDPRLVPTARRIPKLSYAMELAYFGAKVLHPRTIEPAMEKGIP-ILVKNTFEPESEG
2cdqA           EIQVWKDVDGVLTCDPTIYKRTPVPYLTFDEAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPG
2akoA           LLVILSDIDGFYDKNPSEFSDAKRLEKITHIKEEWLHGGIVTKLKAAKFLLEHNK--KFLASGFDLSVAK
2brxB           LLVVITNVDGVYAKKIKKMKP---------EELLEIVGKSVIDPLAAKIIARSGIK-TIVIGKEDAKDLF
3e59A           IRLSIHPQPADLKFGIHMMPTRDDWLTPWHGVAVNTEDRF---VLMKRSEVLELGGELVQINGQPSHYRL
2bmuA           LLVVITNVDGVYTADKKIKKKPEELLEIVGKGIEKAGSSSVIDPLAAKIIARSGIK-TIVIGKEDAKDLF
2bmuB           LLVVITNVDGVYTADKKIKKKPEELLEIVGKGIEKAGSSSVIDPLAAKIIARSGIK-TIVIGKEDAKDLF
2brxA           LLVVITNVDGVYTADPK--KDPTAKKIKKMKPEEEIVGKSVIDPLAAKIIARSGIK-TIVIGKEDAKDLF
2c10B           VTVERHGGPLPYHRRPVLFQEYL--DIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGD
2c10A           VTVERHGGPLPYHRRPVLFQEYLDID--QMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQS--
2a1fE           VVLKATKVDGVYDCAKL-YKNLSYAEVIDK-------ELKVMDLSAFTLARDHGMP-IRVFNMGKPGALR
2a1fD           VVLKATKVDGVYDCAKL-YKNLSYAEVIDK-------ELKVMDLSAFTLARDHGMP-IRVFNMGKPGALR
2a1fA           VVLKATKVDGVYDCAK-LYKNLSYAEV-------------------------------------------
2dt8A           AAFPTTSQPSPEDF-ARVYREALEEADHVLS--LHISGKLSGTVQSAELAAQEFPGRVTVVDTQAASLGV
2a1fF           -------------------------------------ELKVMDLSAFTLARDHGM-PIRVFNMGKPGALR
3bicA           ----------------------------------------------------------------------
2a1uA           ----------------------------------------------------------------------
2a1fC           ---------------------------------------KVMDLSAFTLARDHGMP-IRVFNMGKPGALR


                         .         *         .         .         .         .         +:350
query           LEIFTEGAGTLIVP
2ap9A           VELFTAGTGTKVVR
2bufD           LEIFTSGVGTLISN
2bufC           LEIFTSGVGTLISN
2bufA           LEIFTSGVGTLISN
2btyA           LEIFSKGIGTMIKE
2bufB           LEIFTSGVGTLISN
2bufI           LEIFTSGVGTLIS-
2bufL           LEIFTSGVGTLISN
2ap9B           VELFTAGTGTKVVR
2bufG           LEIFTSGVGTLIS-
2ap9E           VELFTAGTGTKVVR
2bufE           LEIFTSGVGTLIS-
2bufH           LEIFTSGVGTLI--
2bufJ           LEIFTSGVGTLIS-
2bufK           LEIFTSGVGTLIS-
2bufF           LEIFTSGVGTLIS-
2egxC           RAL--SGEGTVV--
3d2pA           --------------
1e19A           E----GKTGTQVLP
2egxA           RAL--SGEGTVV--
2e9yB           ----SLQAGTVVM-
1b7bA           GSMSGEIVGTVV--
3e59B           --------------
3c1nB           TLITNDSDSIVKAI
2e9yA           S----LQAGTVVM-
3c1nD           TLITNDSIVKAIST
3d41A           FSSWPHVRSTRITT
3c1mD           TLITNDMEMS----
3ek6B           RILHGAQIGTLVQG
3ek5A           RILHGAQIGTLVQG
3ek5B           RILHGAQIGTLVQG
2bndB           RVVMGEKEGTLI--
2bneB           RVVMGEKEGTLI--
3ek5F           RILHGAQIGTLVQ-
3d40A           LEFLTPFSSWPAHV
2bneA           RVVMGEKEGTLI--
3ek6A           RILHGAQIGTLVQG
3c1mC           TLITNDMEMSDSIV
3c1nA           LITND---------
2bndA           RVVMGEKEGTLI--
2bnfA           RRVVGEKEGTLI--
2bnfB           LRRVVEKEGTLI--
3e59D           --------------
3c1mA           TLITNDMEMSDSIV
3c1nC           TLITNDMSIVKAIS
2cdqA           TIITKT--------
2akoA           TFLLEQIGGTLF--
2brxB           RVIKGDHNGTTIEP
3e59A           --------------
2bmuA           RVIKGDHNGTTIEP
2bmuB           RVIKGDHNGTTIEP
2brxA           RVIKGDHNGTTIEP
2c10B           RATWFGLYYN----
2c10A           --------------
2a1fE           QVVTGTEEGTTI--
2a1fD           --------------
2a1fA           --------------
2dt8A           G-------------
2a1fF           QVVTGTEEGTTI--
3bicA           --------------
2a1uA           --------------
2a1fC           --------------