[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK86297.2

[Show Plain Result]

#ERROR : Can't open dsspfile "3c3wB.bssp"
#ERROR : Can't open dsspfile "3c3wA.bssp"
#ERROR : Can't open dsspfile "3cwoX.bssp"
#ERROR : Can't open dsspfile "3cloA.bssp"
#ERROR : Can't open dsspfile "3clmA.bssp"
#ERROR : Can't open dsspfile "3b2nA.bssp"
#ERROR : Can't open dsspfile "1dc7A.bssp"
#ERROR : Can't open dsspfile "2czdB.bssp"
#ERROR : Can't open dsspfile "2dvpA.bssp"
#ERROR : Can't open dsspfile "1be1A.bssp"
#ERROR : Can't open dsspfile "3c57B.bssp"
#ERROR : Can't open dsspfile "3cu5B.bssp"
#ERROR : Can't open dsspfile "3c57A.bssp"
#ERROR : Can't open dsspfile "1dbwB.bssp"
#ERROR : Can't open dsspfile "1dc8A.bssp"
#ERROR : Can't open dsspfile "3cz5A.bssp"
#ERROR : Can't open dsspfile "3cz5B.bssp"
#ERROR : Can't open dsspfile "2czdA.bssp"
#ERROR : Can't open dsspfile "1bmtA.bssp"
#ERROR : Can't open dsspfile "3cnbC.bssp"
#ERROR : Can't open dsspfile "1dcmA.bssp"
#ERROR : Can't open dsspfile "1a04A.bssp"
#ERROR : Can't open dsspfile "2cz5A.bssp"
#ERROR : Can't open dsspfile "1d5wA.bssp"
#ERROR : Can't open dsspfile "3cz5C.bssp"
#ERROR : Can't open dsspfile "3cnbA.bssp"
#ERROR : Can't open dsspfile "3cloC.bssp"
#ERROR : Can't open dsspfile "1b1aA.bssp"
#ERROR : Can't open dsspfile "3cu5A.bssp"
#ERROR : Can't open dsspfile "1dz3A.bssp"
#ERROR : Can't open dsspfile "3c2eA.bssp"
#ERROR : Can't open dsspfile "1ccwA.bssp"
#ERROR : Can't open dsspfile "1dbwA.bssp"
#ERROR : Can't open dsspfile "1dcfA.bssp"
#ERROR : Can't open dsspfile "3dgeC.bssp"
#ERROR : Can't open dsspfile "1d5wB.bssp"
#ERROR : Can't open dsspfile "3cfyA.bssp"
#ERROR : Can't open dsspfile "1d4zA.bssp"
#ERROR : Can't open dsspfile "3cg0A.bssp"
#ERROR : Can't open dsspfile "1c4wA.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "3dgfC.bssp"
#ERROR : Can't open dsspfile "2d9sA.bssp"
#ERROR : Can't open dsspfile "1e51B.bssp"
#ERROR : Can't open dsspfile "1e51A.bssp"
#ERROR : Can't open dsspfile "2a9qA.bssp"
#ERROR : Can't open dsspfile "3cg0B.bssp"
#ERROR : Can't open dsspfile "2a9oA.bssp"
#ERROR : Can't open dsspfile "1ab6A.bssp"
#ERROR : Can't open dsspfile "2b4aA.bssp"
#ERROR : Can't open dsspfile "1bqgA.bssp"
#ERROR : Can't open dsspfile "2ayzA.bssp"
#ERROR : Can't open dsspfile "2d00A.bssp"
#ERROR : Can't open dsspfile "1ab5A.bssp"
#ERROR : Can't open dsspfile "2a9rA.bssp"
#ERROR : Can't open dsspfile "2c15A.bssp"
#ERROR : Can't open dsspfile "1chnA.bssp"
#ERROR : Can't open dsspfile "2ayxA.bssp"
#ERROR : Can't open dsspfile "1cyeA.bssp"
#ERROR : Can't open dsspfile "2cheA.bssp"
#ERROR : Can't open dsspfile "3c97A.bssp"
#ERROR : Can't open dsspfile "2c13A.bssp"
#ERROR : Can't open dsspfile "1eb3A.bssp"
#ERROR : Can't open dsspfile "1co0A.bssp"
#ERROR : Can't open dsspfile "1djmA.bssp"
#ERROR : Can't open dsspfile "3cg4A.bssp"
#ERROR : Can't open dsspfile "1e6lA.bssp"
#ERROR : Can't open dsspfile "1aw5A.bssp"
#ERROR : Can't open dsspfile "1a2oA.bssp"
#ERROR : Can't open dsspfile "2dk5A.bssp"
#ERROR : Can't open dsspfile "1e6mA.bssp"
#ERROR : Can't open dsspfile "1e1cA.bssp"
#ERROR : Can't open dsspfile "1ehcA.bssp"
#ERROR : Can't open dsspfile "3crnA.bssp"
#ERROR : Can't open dsspfile "1e6kA.bssp"
#ERROR : Can't open dsspfile "5chyA.bssp"
#ERROR : Can't open dsspfile "6chyA.bssp"
#ERROR : Can't open dsspfile "3chyA.bssp"
#ERROR : Can't open dsspfile "2c13B.bssp"
#ERROR : Can't open dsspfile "3breB.bssp"
#ERROR : Can't open dsspfile "3breA.bssp"
#ERROR : Can't open dsspfile "1e32A.bssp"
#ERROR : Can't open dsspfile "1dpuA.bssp"
#ERROR : Can't open dsspfile "2efnA.bssp"
#ERROR : Can't open dsspfile "2ao9C.bssp"
#ERROR : Can't open dsspfile "3c3mA.bssp"
#ERROR : Can't open dsspfile "3crnB.bssp"
#ERROR : Can't open dsspfile "2cg4A.bssp"
#ERROR : Can't open dsspfile "1b63A.bssp"
#ERROR : Can't open dsspfile "2c19B.bssp"
#ERROR : Can't open dsspfile "2ao9H.bssp"
#ERROR : Can't open dsspfile "1ec9A.bssp"
#ERROR : Can't open dsspfile "3dqqB.bssp"
#ERROR : Can't open dsspfile "2ch4A.bssp"
#ERROR : Can't open dsspfile "1bibA.bssp"
#ERROR : Can't open dsspfile "2c15B.bssp"
#ERROR : Can't open dsspfile "2cfxA.bssp"

## Summary of PDB Search
:216
    2e-21  26%  3c3wB  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    8e-21  26%  3c3wA  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    1e-19  11%  3cwoX  [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
    4e-15  30%  3cloA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    4e-15   8%  3clmA  [x.x.x] TRANSALDOLASE
    4e-12  16%  3b2nA  [x.x.x] UNCHARACTERIZED PROTEIN Q99UF4
    5e-12  19%  1dc7A  [c.23.1] NITROGEN REGULATION PROTEIN
    6e-12  15%  2czdB  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    9e-12   9%  2dvpA  [x.x.x] HYPOTHETICAL PROTEIN PH1917
    1e-11  15%  1be1A  [c.23.6 (1fmfA)] GLUTAMATE MUTASE
    1e-11  49%  3c57B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    2e-11  14%  3cu5B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    2e-11  50%  3c57A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    3e-11  20%  1dbwB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    4e-11  20%  1dc8A  [c.23.1] NITROGEN REGULATION PROTEIN
    6e-11  23%  3cz5A  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    6e-11  23%  3cz5B  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    8e-11  11%  2czdA  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    8e-11   5%  1bmtA  [a.46.1 - c.23.6] METHIONINE SYNTHASE
    9e-11  18%  3cnbC  [x.x.x] DNA-BINDING RESPONSE REGULATOR, MERR FAMILY
    1e-10  20%  1dcmA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    1e-10  37%  1a04A  [c.23.1 - a.4.6] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN
    2e-10  14%  2cz5A  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    3e-10  20%  1d5wA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    4e-10  23%  3cz5C  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    4e-10  19%  3cnbA  [x.x.x] DNA-BINDING RESPONSE REGULATOR, MERR FAMILY
    4e-10  38%  3cloC  [x.x.x] TRANSCRIPTIONAL REGULATOR
    5e-10  16%  1b1aA  [x.x.x] GLUTAMATE MUTASE
    7e-10  16%  3cu5A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    8e-10  20%  1dz3A  [c.23.1] STAGE 0 SPORULATION PROTEIN A
    9e-10  12%  3c2eA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    1e-09  16%  1ccwA  [c.23.6] PROTEIN (GLUTAMATE MUTASE)
    1e-09  20%  1dbwA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    2e-09  21%  1dcfA  [c.23.1] ETR1 PROTEIN
    2e-09  17%  3dgeC  [x.x.x] RESPONSE REGULATOR
    3e-09  20%  1d5wB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    7e-09  17%  3cfyA  [x.x.x] PUTATIVE LUXO REPRESSOR PROTEIN
    1e-08  22%  1d4zA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    1e-08  19%  3cg0A  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    2e-08  17%  1c4wA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    2e-08  19%  1b00A  [c.23.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    3e-08  17%  3dgfC  [x.x.x] RESPONSE REGULATOR
    3e-08  19%  2d9sA  [x.x.x] CBL E3 UBIQUITIN PROTEIN LIGASE
    3e-08  10%  1e51B  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    3e-08  15%  1e51A  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    4e-08  18%  2a9qA  [x.x.x] RESPONSE REGULATOR
    4e-08  19%  3cg0B  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    6e-08  20%  2a9oA  [x.x.x] RESPONSE REGULATOR
    6e-08  19%  1ab6A  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    6e-08  13%  2b4aA  [x.x.x] BH3024
    7e-08  10%  1bqgA  [x.x.x] D-GLUCARATE DEHYDRATASE
    1e-07  24%  2ayzA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    1e-07  11%  2d00A  [x.x.x] V-TYPE ATP SYNTHASE SUBUNIT F
    1e-07  19%  1ab5A  [c.23.1] CHEY
    2e-07  21%  2a9rA  [x.x.x] DNA-BINDING RESPONSE REGULATOR
    3e-07   9%  2c15A  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    3e-07  21%  1chnA  [x.x.x] CHEY
    5e-07  23%  2ayxA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    7e-07  20%  1cyeA  [x.x.x] CHEY
    7e-07  19%  2cheA  [x.x.x] CHEY
    7e-07  16%  3c97A  [x.x.x] SIGNAL TRANSDUCTION HISTIDINE KINASE
    1e-06  10%  2c13A  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    1e-06  13%  1eb3A  [c.1.10] 5-AMINOLAEVULINIC ACID DEHYDRATASE
    1e-06  16%  1co0A  [a.4.12] TRP OPERON REPRESSOR
    2e-06  21%  1djmA  [c.23.1] CHEMOTAXIS PROTEIN Y
    2e-06  15%  3cg4A  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN (CHEY-
    3e-06  18%  1e6lA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    3e-06   8%  1aw5A  [x.x.x] 5-AMINOLEVULINATE DEHYDRATASE
    4e-06  22%  1a2oA  [c.23.1 - c.40.1] CHEB METHYLESTERASE
    4e-06  16%  2dk5A  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA
    4e-06  21%  1e6mA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    5e-06  10%  1e1cA  [c.1.19 - c.23.6] METHYLMALONYL-COA MUTASE ALPHA CHAIN
    6e-06  21%  1ehcA  [x.x.x] CHEY
    9e-06  17%  3crnA  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN, CHEY-
    1e-05  19%  1e6kA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    1e-05  20%  5chyA  [x.x.x] CHEY
    1e-05  21%  6chyA  [c.23.1] CHEY
    2e-05  20%  3chyA  [c.23.1 (1a0oA)] CHEY
    2e-05   5%  2c13B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    2e-05  18%  3breB  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    4e-05  19%  3breA  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    5e-05  10%  1e32A  [b.52.2 - d.31.1 - c.37.1] P97
    5e-05  25%  1dpuA  [a.4.5] REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN
    5e-05  15%  2efnA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    5e-05  19%  2ao9C  [x.x.x] PHAGE PROTEIN
    6e-05  14%  3c3mA  [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
    8e-05  16%  3crnB  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN, CHEY-
    1e-04  17%  2cg4A  [x.x.x] REGULATORY PROTEIN ASNC
    1e-04   8%  1b63A  [d.122.1 - d.14.1] MUTL
    1e-04  18%  2c19B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    2e-04  18%  2ao9H  [x.x.x] PHAGE PROTEIN
    2e-04   7%  1ec9A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    4e-04   7%  3dqqB  [x.x.x] PUTATIVE TRNA SYNTHASE
    4e-04   9%  2ch4A  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    6e-04  23%  1bibA  [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
    8e-04   5%  2c15B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    0.001  13%  2cfxA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR LRPC
:216

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSELVIIIADDHPLFRGALKQAVAGLDGQQTIIEAGDFEAARHAATTRNXXXXXXXXXXXPGVSGFSGLM
3c3wB           -----VFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAM-ARVPAARPDVAVLDVRLPDGNGIELCR
3c3wA           -----VFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAM-ARVPAARPDVAVLDVRLPDGNGIELCR
3cwoX           ------------------------------IVDDATNGREAVEKYK-ELKPDIVTMDITMPEMNGIDAIK
3cloA           ----------------------------------------------------------------------
3clmA           -----STGGKTGFVSLE--------VSPELAKDAQGTVEEARRLHAAIARKNAIKVP---ATDAGIDALE
3b2nA           -----LIIAEDQNMLRQAMVQLIKLHGDFEILADTDNGLDAMKLIE-EYNPNVVILDIEMPGMTGLEVLA
1dc7A           MQRGIVWVVDDDSSIRWVLERALAGAGLT--CTTFENGNEVLAALA-SKTPDVLLSDIRMPGMDGLALLK
2czdB           -------------------------------ALDVYEGERAIKIAKSVKDYISMIKVNWPILGSGVDIIR
2dvpA           -------------------------------TSNPGKVREVANFLGTFGIEIVQLKHEY-PEIQAEKLED
1be1A           ---LGVIGSDCHAVGNKILDHSFTNAGFNVNIGVLSSQEDFINAAIETKADLICVSSLYGQGEIDCKGLR
3c57B           ----------------------------------------------------------------------
3cu5B           -----ILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAIQIALKHPPNVLLTDVRMPRMDGIELVD
3c57A           ----------------------------------------------------------------------
1dbwB           MQDYTVHIVDDEEPVRKSLAFMLTMNGFA--VKMHQSAEAFLAFAP-DVRNGVLVTDLRMPDMSGVELLR
1dc8A           MQRGIVWVVDDDSSIRWVLERALAGAGLTCTT--FENGNEVLAALASKTPDVLLSIRM--PGMDGLALLK
3cz5A           -----IMLVDDHPIVREGYRRLIERRPGYAVVAEAADAGEA-YRLYRETTPDIVVMDLTLPGPGGIEATR
3cz5B           -----IMLVDDHPIVREGYRRLIERRPGYAVVAEAADAGEAYRLYR-ETTPDIVVMDLTLPGPGGIEATR
2czdA           -------------------------------ALDVYEGERAKIAKSVKDYISMIKVNWPLILGSGVDIIR
1bmtA           KMVIATVKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVPAEKILRTAKEVNADLIGLSGLITPVNVAKEME
3cnbC           --DFSILIIEDDKEFADMLTQFLENLFPYAKIKIAYNPFDAGDLLH-TVKPDVVMLDLMMVGMDGFSICH
1dcmA           --DYTVHIVDDEEPVRKSLAFMLTMNG--FAVKMHQSAEAFLAFAPDVRNGVLVTDLRM-PDMSGVELLR
1a04A           -----ILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELA-------------------------
2cz5A           -------------------------------ALDVYEGERAKIAKSVKDYISMIKVNWPLILGSGVDIIR
1d5wA           MQDYTVHIVDDEEPVRKSLAFM---LTMNGFAVKMHQSAEAFLAFA-PDVRNGVLVTLRMPDMSGVELLR
3cz5C           -----IMLVDDHPIVREGYRRLIERRPGYAVVAEAADAGEA-YRLYRETTPDIVVMDLTLPGPGGIEATR
3cnbA           -----ILIIEDDKEFADMLTQFLENLFPYAKIKIAYNPFDAGDLLHTVKPDVVMLDLMMV-GMDGFSICH
3cloC           ----------------------------------------------------------------------
1b1aA           ---LGVIGSDCHAVGNKILDHAFTNAGFNVVNIVLSPQEVFIKAAIETKADAILLSSLYGQGEIDCKGLR
3cu5A           -----ILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAIQIALKHPPNVLLTDVRMPRMDGIELVD
1dz3A           -----VCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQML-EEKRPDILLLDIIMPHLDGLAVLE
3c2eA           -------------------------------------------------------------ATGSITNAV
1ccwA           ---LGVIGSDCHAVGNKILDHAFTNAGFNVVNIVLSPQELFIKAAIETKADAILVSSLYGQGEIDCKGLR
1dbwA           MQDYTVHIVDDEEPVRKSLAFMLTMNGFA--VKMHQSAEAFLAFAPDVRNGVLVTDLRM-PDMSGVELLR
1dcfA           FTGLKVLVMDENGVSRMVTKGLLVHL-GCEVTTVSSNEECLRVV---SHEHKVVFMDVCMPGVENYQIAL
3dgeC           -----VLLVDDSAVLRKIVSFNLKKEGYE--VIEAENGQIALEKLS-EFTPDLIVLDIMMPVMDGFTVLK
1d5wB           MQDYTVHIVDDEEPVRKSLAFM---LTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTLRM-PDMSGVELLR
3cfyA           -----VLLVEDSTSLAILYKQYVKDEPYDIFHVETGRD---AIQFIERSKPQLIILDLKLPDMSGEDVLD
1d4zA           -----FLVVDDFSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNKLQAGGYGFVISDWNM-PNMDGLELLK
3cg0A           -----VLIVEDGRLAAATLRIQLESL-GYDVLGVFDNGEEAVRCAP-DLRPDIALVDIMLCGALDGVETA
1c4wA           -----FLVVDDFSTMRRIVRNLLKELGFNNVEEAED---GVDALNKLQAGGYGFVISWNMPNMDGLELLK
1b00A           -----ILVVEDEAPIREMVCFV---LEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIK
3dgfC           -----VLLVDDSAVLRKIVSFNLKKEG--YEVIEAENGQIA-LEKLSEFTPDLIVLDIMMPVMDGFTVLK
2d9sA           ----------------------------------------------------------------------
1e51B           --------MSYSAKFASCFYGPFRDAARRCYQLPPGARGLALRAVDRDVREGADMLMVK-PGMPYLDIVR
1e51A           -----KFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVD-RDVREGADMLMVKPGMPYLDIVR
2a9qA           -----ILIVDDEKPISDIIKFNMTKEGYE--VVTAFNGREALEQFEAE------QPDIIILDLDGLEVAK
3cg0B           -----VLIVEDGRLAAATLRIQLESL-GYDVLGVFDNGEEAVRCAPDLRPDIALVDIML-CGALDGVETA
2a9oA           -----ILIVDDEKPISDIIKFNMTKEGYE--VVTAFNGREALEQFE-AEQPDIIILDLMLPEIDGLE-VA
1ab6A           -----FLVVDDNSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNKLQAGGYGFVISDWNM-PNMDGLELLK
2b4aA           -----VTLVEDEPSHATLIQYHLNQL-GAEVTVHPSGSAFFQHRSQLSTCDLLIVSDQL-VDLSIFSLLD
1bqgA           KLKGGVLRGEDEIAAVTALSERFPDARITLDPNGAWSLKEAVALCR-DQHHVLAYAEDPCGAENGYSGRE
2ayzA           -----ILVVDDHPINRRLLADQLGSLGYQCKT--ANDGVDALNVLSKNHIDIVLSDVNM-PNMDGYRLTQ
2d00A           MVPVRMAVIADPETAQGFRLAGLEG----YGASSAEEAQSLLETLVERGGYALVAVDEALLPDPERAVER
1ab5A           -----FLVVDDNSTMRRITRNLLKEL-GFNNVEEAEDGVDALNKLQAGGYGFVISDWNM-PNMDGLELLK
2a9rA           -----ILIVDDEKPISDIIKFNMTKE-GYEVVTAFNGREALEQF---EAEQPDIIILLMLPEIDGLEV-A
2c15A           -------GPFRDAVGSASNLGKGNKATYQ--MDPANSDEALHEVA---ADLAEGADMVMVPGMPYLD-IV
1chnA           -----FLVVDDFSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNKLQAGGYGFVISDWNM-PNMDGLELLK
2ayxA           -----ILVVDDHPINRRLLADQLGSLGYQCKTAN--DGVDALNVLSKNHIDIVLSDVNM-PNMDGYRLTQ
1cyeA           DKELKFLVVDDFSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNKL-QAGGYGFVISDWNMPNMDGLELLK
2cheA           -----FLVVDDFSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNK-LQAGGFGFIISDWNMPNMDGLELLK
3c97A           -----VLIAEDNDICRLVAAKALEKCTND--ITVVTNGLQALQAYQ-NRQFDVIIMDIQMPVMDGLEAVS
2c13A           -------GPFRDAVGSASNLGKGNKATYQ--MDPANSDEALHEVAADLAEGADMVMV---PGMPYLD-IV
1eb3A           ------------------------------------------------------------PSTFYLDIMR
1co0A           ----------------------------------------------------------------------
1djmA           MADLKFLVVDDFSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNKL-QAGGYGFVISDWNMPNMDGLELLK
3cg4A           -----DVIVDDDAHVRIAVKTILSDAGFH--IISADSGGQCIDLLKKGFSGVVLLDIPGDGW----DTIR
1e6lA           -----FLVVDAFSTMRRIVRNLLKEL-GFNNVEEAEDGVDA-LNKLQAGGYGFVISDWNMPNMDGLELLK
1aw5A           -----CVAPSDIDGRIRDIKRGLINANLAHKTFVLSY-AAKFSGNLYERDSEGADGIIVKPSTFYLDIVR
1a2oA           MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLI-------------------------
2dk5A           ----------------------------------------------------------------------
1e6mA           -----FLVVDDFSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNKL-QAGGYGFVISAWNMPNMDGLELLK
1e1cA           ---LAKMGQDGHDRGQKVIATAYADLGFDVDVGPLFQTPEETARQAVEADVHVVGVSSLAGGHLTLVPAL
1ehcA           -----FLVVDKFSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNKL-QAGGYGFVISDWNMPNMDGLELLK
3crnA           -----ILIVDDDTAILDSTKQILEFEG--YEVEIAATAGEGLAKIENEFFNLALFIKLPDEGTE-----L
1e6kA           MRSLKFLVVADFSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNKLQAGGYGFVISDWNM-PNMDGLELLK
5chyA           -----FLVVDDFSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNKL-QAGGYGFVISDWNMPNMDGLELLK
6chyA           -----FLVVDDFSTMRRIVRNLLKEL-GFNNVEEAEDGVDA-LNKLQAGGYGFVISDWNMPNMDGLELLK
3chyA           -----FLVVDDFSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNKL-QAGGYGFVISDWNMPNMDGLELLI
2c13B           ------------------------------------------------------------VPGMPYLDIV
3breB           -----VLLVDDQAMIGEAVRRSLASE-AGIDFHFCSDPQQAVAVA-NQIKPTVILQDLVMPGVDGLTLLA
3breA           -----VLLVDDQAMIGEAVRRSLASEAGID-FHFCSDPQQAVAVANQIK-PTVILQDLVMPGVDGLTLLA
1e32A           ------------------------------------------------------------EVYLKPYFLE
1dpuA           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------
2ao9C           ----------------------------------------------------------------------
3c3mA           -----ILVVDDSPIVDVFVTLERGGYR----PITAFSGEECLEALNATPPDLVLLDIEPDGWETLERIKT
3crnB           -----ILIVDDDTAILDSTKQILEFEG--YEVEIAATAGEGLAKIENEFFNLALFIKLP-----DEGTEL
2cg4A           ----------------------------------------------------------------------
1b63A           RFDVTINLSHNGKIVRQYRAVPEGGQK--ERRLGAICGTAFLEQALAIEWQHGDLTL---RGWVADPNHT
2c19B           ------------------------------------------------------------PGMPYLDIVR
2ao9H           ----------------------------------------------------------------------
1ec9A           ----------------------------------------------------------------SGREVM
3dqqB           -----IGVIADDFTGATDIASFLVENG--MPTVQINDVPTGTQPE-GCDAVVISLKTRSCPAQEAIKQSL
2ch4A           IANIDTILSISKEDIQRVQDRDVIVIRGEVIPVYRLW-EVLQIEHKEELEEMEAVIVRVGNRKYGIVVDD
1bibA           ----------------------------------------------------------------------
2c15B           --------------------------------------------------------------------IV
2cfxA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ALRAEFSSLPIVIVSATDDATTVRRSIELGASGFISKSSGIDDIRDGIRAVLEGDVWIPSGHQGEKEQDP
3c3wB           DLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNAAAALMAKLR
3c3wA           DLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNAAAALMAKLR
3cwoX           EIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVNTAAVENPSLITQIAQTFGSQAVVVAIDAKRVDG
3cloA           ----------------------------------------------------------------------
3clmA           TLVSDGISVNLTLLFSRAQTLKAYAAYARGIAKRLAAGQSVAHIQVVASFFISRVDSALLPDRLKGKTAI
3b2nA           EIRKKHLNIKVIIVTTFKRPGYFEKAVVNDVDAYVLKERSIEELVETINKVN------------------
1dc7A           QIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISH----------------
2czdB           RLKEETGVEIIADDIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKELGEIIMVVEMSHPGALEFIN
2dvpA           VVDFGISWLKGKVPEPFGLFIESLKGFPGVYSSYVYRTIGLEGILKLMEGAEDRRAYFKSVIGFYIDGKA
1be1A           EKCDEAGLKGIKLFVKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEVLGVE---------------
3c57B           ----------------------------------------------------------------------
3cu5B           NILKLYPDCSVIFMSGYSDKEYLKAAIKFRAIRYVEKPIDPSEIMDALKQSIQTVLQHQA----------
3c57A           ----------------------------------------------------------------------
1dbwB           NLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLVAL------------
1dc8A           QIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISH----------------
3cz5A           HIRQWDGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAILAGRRAMSP----------
3cz5B           HIRQWDGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAILAGRRAMSP----------
2czdA           RLKEETGVELKLADIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKSHPGALEFINPLTDRFIEVAN
1bmtA           RQGFTIPLLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRTVGVVAALLSDTQRDDFVARTEYETVRIQH
3cnbC           RIKSATANIIVIAMTGALTDDNVSRIVALGAETCFGKPLNFTLLEKTIKQLVE-----------------
1dcmA           NLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV--------------
1a04A           ----------------------------------------------------------------------
2cz5A           RLKEETGVEIILADIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKELGEIIMVVEMSHPGALEFIN
1d5wA           NLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV--------------
3cz5C           HIRQWDGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAILAGRRAMSP----------
3cnbA           RIKSTPANIIVIAMTGALTDDNVSRIVALGAETCFGKPLNFTLLEKTIKQLVEQ----------------
3cloC           ----------------------------------------------------------------------
1b1aA           QKCDEAGLEGILLVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE---------------
3cu5A           NILKLYPDCSVIFMSGYSDK------EYLRAIRYVEKPIDPSEIMDALKQSIQT----------------
1dz3A           RIRGFEHQPNVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQVYG-----------------
3c2eA           KNARAVCGFAVKIEVECLSEDEATEAIEAGADVIMLDNHFLLECSGGLNLLCDDIDIYS---TSSIHQGT
1ccwA           QKCDEAGLEGILLVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE---------------
1dbwA           NLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV--------------
1dcfA           RIHEKFTQRLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDLLEP----------------
3dgeC           KLQEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLN-----------------
1d5wB           NLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASE-----------------
3cfyA           WINQNDIPTSVIIATAHGSVDLAVNLIQKGAEDFLEKPINADRLKTSVALHLKR----------------
1d4zA           TIRAAMSALPVLMVTAEAKKENVIAAAQAGASGYVVKPFTAATLEEKLNKIFEK----------------
3cg0A           ARLAAGCNLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAADTLHRSIEMAIHK----------------
1c4wA           TIRAAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK----------------
1b00A           HLKRETRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR-----------------
3dgfC           KLQEKEEWKRIIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLL------------------
2d9sA           ----------------------------------------------------------------------
1e51B           EVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQ----------
1e51A           EVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQ----------
2a9qA           TIRKTSSVPILML-SAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR-----------------
3cg0B           ARLAAGCNLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAADTLHRSIEMAIHK----------------
2a9oA           KTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR-----------------
1ab6A           TIRADGAMSALPVLMTTAEAKNIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK----------------
2b4aA           IVKEQTKQPSVLILTTGRL-----IESSEHNLSYLQKPFAISELRAAIDYHK------------------
1bqgA           VMAERSTGLRTATNMIATDWRQMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNEWWGSHSNNHFD-IS
2ayzA           RIRQLGLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAER----------------
2d00A           LMRGRDL--PVLLPIAGLKEAFQGHDVEGYMRELVRK---------------------------------
1ab5A           TIRADGAMSALPVLMVTAEAKNIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK----------------
2a9rA           KTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLR-----------------
2c15A           RRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAFKRAGADGI------------------
1chnA           TIRAAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK----------------
2ayxA           RIRQLGLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAE-----------------
1cyeA           TIRADGAMSALPVLMVTAEAENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK----------------
2cheA           TIRADSAMSALPVLMVTAEAKNIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK----------------
3c97A           EIRNYERTHNTKRASAITADTIDDDRPGAELDEYVSKPLNPNQLRDVVLTCH------------------
2c13A           RRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAF--------------------------
1eb3A           DASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIA--FESHQGFLRAGARL----------------
1co0A           ----------------------------------------------------------------------
1djmA           TIRGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK----------------
3cg4A           AILDNSLEQGIAIVLTAKNAPDAKIGLQEYVVDYITKPFDNEDLIEKTTFFG------------------
1e6lA           TIRADGAMSALPVLMVTAEAENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK----------------
1aw5A           DASEICKDLPICAYHVSGEY----ALHAAAEKGVVDLKTIAFESHQGFLRAGAR----------------
1a2oA           ----------------------------------------------------------------------
2dk5A           ------------------------------------------------------------------SGDS
1e6mA           TIRAAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK----------------
1e1cA           RKELDKLGDILITVGGVIPEQDFDELRKDGAVEIYTPGTVIPESAISLVKKLRA----------------
1ehcA           TIRAAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK----------------
3crnA           LEKAHKLRPGKKIVTGYASLENSVFSLNAGADAYI-KPVNPRDLLEKIKEKLDE----------------
1e6kA           TIRADGAMSALPVLMVTAEAKNIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK----------------
5chyA           TADGAMSALPVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEK----------------
6chyA           TIRAAMSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEK----------------
3chyA           RADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEK----------------
2c13B           RRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAFKRAGADGIL-----------------
3breB           AYRGNPATRDIPIIVLSTKEEPTVK---------------------------------------------
3breA           AYRGNPATRDIPIIVLSTKEEPTVKSAAFAAGANDYL---------------------------------
1e32A           AYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDE-----------------
1dpuA           ----------------------------------------------------------------------
2efnA           ----------------------------------------------------------------------
2ao9C           ----------------------------------------------------------------------
3c3mA           DPATRDIPVLL---TAKPLTPEEANEYGSYIEDYILKPTTHHQLYEAIEHVLA-----------------
3crnB           LEKAHKLRPGKKIVTGYASLENSVFSLNAGADAYI-KPVNPRDLLEKIKEKLDE----------------
2cg4A           ----------------------------------------------------------------------
1b63A           TPALAEIQ-YCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDV--------------
2c19B           RVKDEFRAPTFVYQVSGEYAMHMGA----IQNGWLAESVILESLTAFKRAGADG----------------
2ao9H           ----------------------------------------------------------------------
1ec9A           AEFRRATGLPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFWGSHSNNHFDISL
3dqqB           AALVKKQGCQQVYFKYCST---------------------------------------------------
2ch4A           LLG--QDDIVIKSLGKVFSEVKEFSGAAILGDGSIALIINVSGI--------------------------
1bibA           ----------------------------------------------------------------------
2c15B           RRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAFKRAGADGIL-----------------
2cfxA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DVADLIGRLRTLTPQQSRVLGMLAEGLLNKQIAYELNVSEATIKAHVSAILLKLKVDSRTQAVIQLAKxx
3c3wB           GAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAA-------
3c3wA           GAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAA-------
3cwoX           EFMVFTYSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIAS-----
3cloA           -------HRNILSEREKEILRCIRKGLSSKEIAATLYISVNTVNRHRQNILEKLSVGNSIEACR------
3clmA           ALAKAAYQDWEQYFTAPEFAALEAQGANRVQLLWASTGVKNPAYPDTLYVDSLIGVHTVNTVP-------
3b2nA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
2czdB           P----LTDRFIEVANEIEPFGVIAPGTRPERIGYIRDRLKADYIIVGRAIYNAPNPREAAKAIYD-----
2dvpA           YKFSGVTWGRISNEKRGTGYDPIFIPEGSEKTFAEMTIEEKNALSHRGKALKAFF---------------
1be1A           ----------------------------------------------------------------------
3c57B           ------------TDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQ---------
3cu5B           ----------------------------------------------------------------------
3c57A           -----------LTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQ---------
1dbwB           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
2czdA           EIEPFGVIAPGTRPERIGYIRDRLKEGIKILAPGIAVKAGADYIIVGRAIYNAPNPREAAKAIYD-----
1bmtA           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1a04A           ---------------------LIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAV------
2cz5A           PLTDRFIEAPGTRPERIGYIRDRLKEGIKILAAKDAVKAGADYIIVGRAIYNAPNPREAAKAIYD-----
1d5wA           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
3cloC           -------------------------GLSSKEIAATLYISVNTVNRHRQNILEKLSVGNSIEACR------
1b1aA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
3c2eA           PVIDFSLKL-------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
2d9sA           ----------------SEIERLMSQGYSYQDIQKALVIAHNNIEMAKN-ILREFSGPSS-----------
1e51B           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
1bqgA           LAMFTHVAAAAITAIDTHWIWQDGQRLT------------------------------------------
2ayzA           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2c15A           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
1co0A           -------EREALGTRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSLAAPVELRQWLEEVLL-----
1djmA           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
2dk5A           QNAGK---MKGSDNQEKLVYQIIEDGIWSRDVRYKSNLPLTEINKILK----------------------
1e6mA           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
1dpuA           -----------LTVAQNQVLNLIKAGLNFQDLKNQLKMSVSSIKQAVDFLSNEGHIYSTVDDD-------
2efnA           -----------MDEIDLRILKILQYNYSLDEIAREIRIPKATLSYRIKKLEKDGVIKGYYAYI-------
2ao9C           -MAKLDELKQKLTAKQIQAAYLLEEKRTQDEMANELGINRTTLWEWRTKNQDFIAFKSEVADSFLAEK--
3c3mA           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
2cg4A           -----------IDNLDRGILEALMGNTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDV-------
1b63A           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
2ao9H           --AKLDELKQKLTAKQIQAAYESEEKRTQDEMANELGINRTTLWEWRTKNQDFIAFKSEVADSFLAEK--
1ec9A           AMFTHVAAAPGKITAIDTHWIWQE--GNQRLTKEPFEIKGGLVQV-------------------------
3dqqB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
1bibA           -----------DNTVPLKLIALLANGHSGEQLGETLGMSRAAINKHIQTL--------------------
2c15B           ----------------------------------------------------------------------
2cfxA           ----------KLDQIDLNIIEELKKDLSMRELGRKIKLSPPSVTERVRQLESFGIIKQYTLEV-------


                         .         .         .         +         .         .         .:280
query           xxxxxx
3c3wB           ------
3c3wA           ------
3cwoX           ------
3cloA           ------
3clmA           ------
3b2nA           ------
1dc7A           ------
2czdB           ------
2dvpA           ------
1be1A           ------
3c57B           ------
3cu5B           ------
3c57A           ------
1dbwB           ------
1dc8A           ------
3cz5A           ------
3cz5B           ------
2czdA           ------
1bmtA           ------
3cnbC           ------
1dcmA           ------
1a04A           ------
2cz5A           ------
1d5wA           ------
3cz5C           ------
3cnbA           ------
3cloC           ------
1b1aA           ------
3cu5A           ------
1dz3A           ------
3c2eA           ------
1ccwA           ------
1dbwA           ------
1dcfA           ------
3dgeC           ------
1d5wB           ------
3cfyA           ------
1d4zA           ------
3cg0A           ------
1c4wA           ------
1b00A           ------
3dgfC           ------
2d9sA           ------
1e51B           ------
1e51A           ------
2a9qA           ------
3cg0B           ------
2a9oA           ------
1ab6A           ------
2b4aA           ------
1bqgA           ------
2ayzA           ------
2d00A           ------
1ab5A           ------
2a9rA           ------
2c15A           ------
1chnA           ------
2ayxA           ------
1cyeA           ------
2cheA           ------
3c97A           ------
2c13A           ------
1eb3A           ------
1co0A           ------
1djmA           ------
3cg4A           ------
1e6lA           ------
1aw5A           ------
1a2oA           ------
2dk5A           ------
1e6mA           ------
1e1cA           ------
1ehcA           ------
3crnA           ------
1e6kA           ------
5chyA           ------
6chyA           ------
3chyA           ------
2c13B           ------
3breB           ------
3breA           ------
1e32A           ------
1dpuA           ------
2efnA           ------
2ao9C           ------
3c3mA           ------
3crnB           ------
2cg4A           ------
1b63A           ------
2c19B           ------
2ao9H           ------
1ec9A           ------
3dqqB           ------
2ch4A           ------
1bibA           ------
2c15B           ------
2cfxA           ------