[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK86457.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2eg5A.bssp"
#ERROR : Can't open dsspfile "3dp7A.bssp"
#ERROR : Can't open dsspfile "2aowA.bssp"
#ERROR : Can't open dsspfile "3busA.bssp"
#ERROR : Can't open dsspfile "1dl5A.bssp"
#ERROR : Can't open dsspfile "3e7pA.bssp"
#ERROR : Can't open dsspfile "3bwbA.bssp"
#ERROR : Can't open dsspfile "2eg5E.bssp"
#ERROR : Can't open dsspfile "3bgvA.bssp"
#ERROR : Can't open dsspfile "1dl5B.bssp"
#ERROR : Can't open dsspfile "3busB.bssp"
#ERROR : Can't open dsspfile "2as0A.bssp"
#ERROR : Can't open dsspfile "2an4A.bssp"
#ERROR : Can't open dsspfile "1d2gA.bssp"
#ERROR : Can't open dsspfile "3bgvB.bssp"
#ERROR : Can't open dsspfile "2an3B.bssp"
#ERROR : Can't open dsspfile "2aotB.bssp"
#ERROR : Can't open dsspfile "3b5iB.bssp"
#ERROR : Can't open dsspfile "2an3A.bssp"
#ERROR : Can't open dsspfile "3dlcA.bssp"
#ERROR : Can't open dsspfile "2aztB.bssp"
#ERROR : Can't open dsspfile "2dulA.bssp"
#ERROR : Can't open dsspfile "2b2cA.bssp"
#ERROR : Can't open dsspfile "2an4B.bssp"
#ERROR : Can't open dsspfile "2bm8K.bssp"
#ERROR : Can't open dsspfile "3bkxA.bssp"
#ERROR : Can't open dsspfile "3c6kB.bssp"
#ERROR : Can't open dsspfile "3dp7B.bssp"
#ERROR : Can't open dsspfile "3egeA.bssp"
#ERROR : Can't open dsspfile "2a14A.bssp"
#ERROR : Can't open dsspfile "1bhjA.bssp"
#ERROR : Can't open dsspfile "1d2hA.bssp"
#ERROR : Can't open dsspfile "3b3gA.bssp"
#ERROR : Can't open dsspfile "2e5wA.bssp"
#ERROR : Can't open dsspfile "2b25B.bssp"
#ERROR : Can't open dsspfile "1dusA.bssp"
#ERROR : Can't open dsspfile "3c6kA.bssp"
#ERROR : Can't open dsspfile "3ccfA.bssp"
#ERROR : Can't open dsspfile "2aotA.bssp"
#ERROR : Can't open dsspfile "3c6mA.bssp"
#ERROR : Can't open dsspfile "3c6mB.bssp"
#ERROR : Can't open dsspfile "2cmgA.bssp"
#ERROR : Can't open dsspfile "3bwbB.bssp"
#ERROR : Can't open dsspfile "3c6mD.bssp"
#ERROR : Can't open dsspfile "3b3fA.bssp"
#ERROR : Can't open dsspfile "3bgvC.bssp"
#ERROR : Can't open dsspfile "2bh2A.bssp"
#ERROR : Can't open dsspfile "3e8sA.bssp"
#ERROR : Can't open dsspfile "2ejuA.bssp"
#ERROR : Can't open dsspfile "3e05B.bssp"
#ERROR : Can't open dsspfile "2e58D.bssp"
#ERROR : Can't open dsspfile "3dliA.bssp"
#ERROR : Can't open dsspfile "2e58B.bssp"
#ERROR : Can't open dsspfile "2b9eA.bssp"
#ERROR : Can't open dsspfile "3bkwA.bssp"
#ERROR : Can't open dsspfile "2bm9B.bssp"
#ERROR : Can't open dsspfile "3c3yA.bssp"
#ERROR : Can't open dsspfile "2br5D.bssp"
#ERROR : Can't open dsspfile "3e05G.bssp"
#ERROR : Can't open dsspfile "3egiB.bssp"
#ERROR : Can't open dsspfile "2bh2B.bssp"
#ERROR : Can't open dsspfile "2aouB.bssp"
#ERROR : Can't open dsspfile "3ccfB.bssp"
#ERROR : Can't open dsspfile "1dctA.bssp"
#ERROR : Can't open dsspfile "3c3pA.bssp"
#ERROR : Can't open dsspfile "3bzbA.bssp"
#ERROR : Can't open dsspfile "3cjtA.bssp"
#ERROR : Can't open dsspfile "3a25A.bssp"
#ERROR : Can't open dsspfile "3bzbB.bssp"
#ERROR : Can't open dsspfile "3cggB.bssp"
#ERROR : Can't open dsspfile "2br5E.bssp"
#ERROR : Can't open dsspfile "3bgdA.bssp"
#ERROR : Can't open dsspfile "3eeyB.bssp"
#ERROR : Can't open dsspfile "2e5wB.bssp"
#ERROR : Can't open dsspfile "2bm8B.bssp"
#ERROR : Can't open dsspfile "2admA.bssp"
#ERROR : Can't open dsspfile "1cmvB.bssp"
#ERROR : Can't open dsspfile "3bxoA.bssp"
#ERROR : Can't open dsspfile "3c3pC.bssp"
#ERROR : Can't open dsspfile "3a17D.bssp"
#ERROR : Can't open dsspfile "3eeyI.bssp"
#ERROR : Can't open dsspfile "2br4F.bssp"
#ERROR : Can't open dsspfile "2e58A.bssp"
#ERROR : Can't open dsspfile "3bt7A.bssp"
#ERROR : Can't open dsspfile "2bm8G.bssp"
#ERROR : Can't open dsspfile "3c6mC.bssp"
#ERROR : Can't open dsspfile "3bwcB.bssp"
#ERROR : Can't open dsspfile "3c3pB.bssp"
#ERROR : Can't open dsspfile "1aqjA.bssp"
#ERROR : Can't open dsspfile "2bm8A.bssp"
#ERROR : Can't open dsspfile "1e50Q.bssp"
#ERROR : Can't open dsspfile "3eeyA.bssp"
#ERROR : Can't open dsspfile "3e05E.bssp"
#ERROR : Can't open dsspfile "1admA.bssp"
#ERROR : Can't open dsspfile "3b5iA.bssp"
#ERROR : Can't open dsspfile "3e05A.bssp"
#ERROR : Can't open dsspfile "3e05D.bssp"
#ERROR : Can't open dsspfile "2br3D.bssp"
#ERROR : Can't open dsspfile "3cvoA.bssp"
#ERROR : Can't open dsspfile "3c0kA.bssp"
#ERROR : Can't open dsspfile "3cjqD.bssp"
#ERROR : Can't open dsspfile "3bwmA.bssp"
#ERROR : Can't open dsspfile "2ckdA.bssp"
#ERROR : Can't open dsspfile "3a17B.bssp"
#ERROR : Can't open dsspfile "3bgvD.bssp"
#ERROR : Can't open dsspfile "1aqiA.bssp"
#ERROR : Can't open dsspfile "2br3B.bssp"
#ERROR : Can't open dsspfile "3e05H.bssp"
#ERROR : Can't open dsspfile "3egiD.bssp"
#ERROR : Can't open dsspfile "3egiA.bssp"
#ERROR : Can't open dsspfile "3e05C.bssp"
#ERROR : Can't open dsspfile "3duwA.bssp"
#ERROR : Can't open dsspfile "2b25A.bssp"
#ERROR : Can't open dsspfile "1cmoA.bssp"
#ERROR : Can't open dsspfile "2aztA.bssp"
#ERROR : Can't open dsspfile "3cggA.bssp"
#ERROR : Can't open dsspfile "3cc8A.bssp"
#ERROR : Can't open dsspfile "2cwwB.bssp"
#ERROR : Can't open dsspfile "3cjqA.bssp"
#ERROR : Can't open dsspfile "3d2lC.bssp"
#ERROR : Can't open dsspfile "3dh0A.bssp"
#ERROR : Can't open dsspfile "3a15B.bssp"
#ERROR : Can't open dsspfile "1e50A.bssp"
#ERROR : Can't open dsspfile "3bkwB.bssp"
#ERROR : Can't open dsspfile "3e05F.bssp"
#ERROR : Can't open dsspfile "2br3A.bssp"
#ERROR : Can't open dsspfile "2br4A.bssp"
#ERROR : Can't open dsspfile "2b3tA.bssp"
#ERROR : Can't open dsspfile "2dpmA.bssp"
#ERROR : Can't open dsspfile "3e23A.bssp"
#ERROR : Can't open dsspfile "3bwcA.bssp"
#ERROR : Can't open dsspfile "1aqjB.bssp"
#ERROR : Can't open dsspfile "3c6kD.bssp"
#ERROR : Can't open dsspfile "1eanA.bssp"
#ERROR : Can't open dsspfile "2cwwA.bssp"
#ERROR : Can't open dsspfile "3cjqG.bssp"
#ERROR : Can't open dsspfile "2br3F.bssp"
#ERROR : Can't open dsspfile "3ckkA.bssp"
#ERROR : Can't open dsspfile "3dulA.bssp"
#ERROR : Can't open dsspfile "3dh0B.bssp"
#ERROR : Can't open dsspfile "3eeyC.bssp"
#ERROR : Can't open dsspfile "1eg2A.bssp"
#ERROR : Can't open dsspfile "2ar0B.bssp"
#ERROR : Can't open dsspfile "1co1A.bssp"
#ERROR : Can't open dsspfile "2br5F.bssp"
#ERROR : Can't open dsspfile "1eizA.bssp"
#ERROR : Can't open dsspfile "2d16A.bssp"
#ERROR : Can't open dsspfile "3cjtG.bssp"
#ERROR : Can't open dsspfile "3bwyA.bssp"
#ERROR : Can't open dsspfile "1booA.bssp"
#ERROR : Can't open dsspfile "3eeyF.bssp"
#ERROR : Can't open dsspfile "3dtnB.bssp"
#ERROR : Can't open dsspfile "2avnA.bssp"
#ERROR : Can't open dsspfile "3dxzA.bssp"
#ERROR : Can't open dsspfile "2ekmA.bssp"
#ERROR : Can't open dsspfile "2br5C.bssp"
#ERROR : Can't open dsspfile "3dulB.bssp"
#ERROR : Can't open dsspfile "3eeyG.bssp"
#ERROR : Can't open dsspfile "2br5A.bssp"
#ERROR : Can't open dsspfile "3cbgA.bssp"
#ERROR : Can't open dsspfile "3dr5A.bssp"
#ERROR : Can't open dsspfile "3dtnA.bssp"
#ERROR : Can't open dsspfile "2cl5B.bssp"
#ERROR : Can't open dsspfile "2cl5A.bssp"
#ERROR : Can't open dsspfile "2bt8A.bssp"
#ERROR : Can't open dsspfile "1af7A.bssp"
#ERROR : Can't open dsspfile "3c6kC.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "3cjrA.bssp"
#ERROR : Can't open dsspfile "2bzgA.bssp"
#ERROR : Can't open dsspfile "3dxyA.bssp"
#ERROR : Can't open dsspfile "2d16B.bssp"
#ERROR : Can't open dsspfile "3dxxA.bssp"
#ERROR : Can't open dsspfile "1e50C.bssp"
#ERROR : Can't open dsspfile "1eaoA.bssp"
#ERROR : Can't open dsspfile "2avdA.bssp"
#ERROR : Can't open dsspfile "2ckdB.bssp"
#ERROR : Can't open dsspfile "1bc5A.bssp"
#ERROR : Can't open dsspfile "3douA.bssp"
#ERROR : Can't open dsspfile "3cjtC.bssp"
#ERROR : Can't open dsspfile "3d2lA.bssp"
#ERROR : Can't open dsspfile "3a27A.bssp"
#ERROR : Can't open dsspfile "1e50E.bssp"
#ERROR : Can't open dsspfile "3dmfA.bssp"

## Summary of PDB Search
:418
    3e-35  12%  2eg5A  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    1e-32  11%  3dp7A  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    2e-29  10%  2aowA  [x.x.x] HISTAMINE N-METHYLTRANSFERASE
    2e-28  18%  3busA  [x.x.x] METHYLTRANSFERASE
    3e-28  13%  1dl5A  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    2e-26  15%  3e7pA  [x.x.x] PUTATIVE METHYLTRANSFERASE
    2e-26  11%  3bwbA  [x.x.x] SPERMIDINE SYNTHASE
    3e-26  15%  2eg5E  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    1e-25   9%  3bgvA  [x.x.x] MRNA CAP GUANINE-N7 METHYLTRANSFERASE
    7e-25  13%  1dl5B  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    1e-23  18%  3busB  [x.x.x] METHYLTRANSFERASE
    2e-23  14%  2as0A  [x.x.x] HYPOTHETICAL PROTEIN PH1915
    4e-23  19%  2an4A  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    6e-23  11%  1d2gA  [c.66.1] GLYCINE N-METHYLTRANSFERASE
    9e-23   8%  3bgvB  [x.x.x] MRNA CAP GUANINE-N7 METHYLTRANSFERASE
    9e-23  17%  2an3B  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    4e-22  11%  2aotB  [x.x.x] HISTAMINE N-METHYLTRANSFERASE
    4e-22  12%  3b5iB  [x.x.x] S-ADENOSYL-L-METHIONINE:SALICYLIC ACID CARBOXYL
    7e-22  19%  2an3A  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    1e-21  11%  3dlcA  [x.x.x] PUTATIVE S-ADENOSYL-L-METHIONINE-DEPENDENT
    1e-21  11%  2aztB  [x.x.x] GLYCINE N-METHYLTRANSFERASE
    2e-21  10%  2dulA  [x.x.x] N(2),N(2)-DIMETHYLGUANOSINE TRNA
    6e-21  12%  2b2cA  [x.x.x] SPERMIDINE SYNTHASE
    8e-21  17%  2an4B  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    8e-21  10%  2bm8K  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-20  15%  3bkxA  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    2e-20  13%  3c6kB  [x.x.x] SPERMINE SYNTHASE
    3e-20   9%  3dp7B  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    3e-20  13%  3egeA  [x.x.x] PUTATIVE METHYLTRANSFERASE FROM ANTIBIOTIC
    3e-20  13%  2a14A  [x.x.x] INDOLETHYLAMINE N-METHYLTRANSFERASE
    4e-20  11%  1bhjA  [c.66.1] GLYCINE N-METHYLTRANSFERASE
    5e-20  11%  1d2hA  [c.66.1] GLYCINE N-METHYLTRANSFERASE
    5e-20  13%  3b3gA  [x.x.x] HISTONE-ARGININE METHYLTRANSFERASE CARM1
    7e-20  11%  2e5wA  [x.x.x] PROBABLE SPERMIDINE SYNTHASE
    3e-19  12%  2b25B  [x.x.x] HYPOTHETICAL PROTEIN
    3e-19  11%  1dusA  [c.66.1] MJ0882
    5e-19  12%  3c6kA  [x.x.x] SPERMINE SYNTHASE
    6e-19  16%  3ccfA  [x.x.x] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE
    7e-19  10%  2aotA  [x.x.x] HISTAMINE N-METHYLTRANSFERASE
    8e-19  13%  3c6mA  [x.x.x] SPERMINE SYNTHASE
    8e-19  12%  3c6mB  [x.x.x] SPERMINE SYNTHASE
    1e-18  11%  2cmgA  [x.x.x] SPERMIDINE SYNTHASE
    2e-18  13%  3bwbB  [x.x.x] SPERMIDINE SYNTHASE
    2e-18  13%  3c6mD  [x.x.x] SPERMINE SYNTHASE
    3e-18  12%  3b3fA  [x.x.x] HISTONE-ARGININE METHYLTRANSFERASE CARM1
    3e-18   8%  3bgvC  [x.x.x] MRNA CAP GUANINE-N7 METHYLTRANSFERASE
    4e-18   9%  2bh2A  [x.x.x] 23S RRNA (URACIL-5-)-METHYLTRANSFERASE RUMA
    5e-18  12%  3e8sA  [x.x.x] PUTATIVE SAM DEPENDENT METHYLTRANSFERASE
    6e-18  11%  2ejuA  [x.x.x] N(2),N(2)-DIMETHYLGUANOSINE TRNA
    7e-18  10%  3e05B  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    8e-18  12%  2e58D  [x.x.x] MNMC2
    2e-17  14%  3dliA  [x.x.x] METHYLTRANSFERASE
    2e-17  12%  2e58B  [x.x.x] MNMC2
    4e-17  14%  2b9eA  [x.x.x] NOL1/NOP2/SUN DOMAIN FAMILY, MEMBER 5 ISOFORM 2
    4e-17  16%  3bkwA  [x.x.x] S-ADENOSYLMETHIONINE DEPENDENT METHYLTRANSFERASE
    7e-17  10%  2bm9B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    7e-17  14%  3c3yA  [x.x.x] O-METHYLTRANSFERASE
    7e-17  11%  2br5D  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    7e-17  12%  3e05G  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    1e-16  15%  3egiB  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    1e-16  12%  2bh2B  [x.x.x] 23S RRNA (URACIL-5-)-METHYLTRANSFERASE RUMA
    2e-16  12%  2aouB  [x.x.x] HISTAMINE N-METHYLTRANSFERASE
    2e-16  15%  3ccfB  [x.x.x] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE
    3e-16   8%  1dctA  [c.66.1] PROTEIN (MODIFICATION METHYLASE HAEIII)
    4e-16  13%  3c3pA  [x.x.x] METHYLTRANSFERASE
    5e-16   9%  3bzbA  [x.x.x] UNCHARACTERIZED PROTEIN
    5e-16  18%  3cjtA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    1e-15  15%  3a25A  [x.x.x] UNCHARACTERIZED PROTEIN PH0793
    2e-15   8%  3bzbB  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-15  16%  3cggB  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    2e-15   9%  2br5E  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-15  15%  3bgdA  [x.x.x] THIOPURINE S-METHYLTRANSFERASE
    2e-15  12%  3eeyB  [x.x.x] PUTATIVE RRNA METHYLASE
    2e-15  12%  2e5wB  [x.x.x] PROBABLE SPERMIDINE SYNTHASE
    3e-15  10%  2bm8B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    4e-15  12%  2admA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    4e-15  16%  1cmvB  [b.57.1] HUMAN CYTOMEGALOVIRUS PROTEASE
    5e-15  18%  3bxoA  [x.x.x] N,N-DIMETHYLTRANSFERASE
    5e-15  11%  3c3pC  [x.x.x] METHYLTRANSFERASE
    5e-15   7%  3a17D  [x.x.x] ALDOXIME DEHYDRATASE
    1e-14  12%  3eeyI  [x.x.x] PUTATIVE RRNA METHYLASE
    1e-14  10%  2br4F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-14  10%  2e58A  [x.x.x] MNMC2
    2e-14   7%  3bt7A  [x.x.x] TRNA (URACIL-5-)-METHYLTRANSFERASE
    2e-14  10%  2bm8G  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    3e-14  13%  3c6mC  [x.x.x] SPERMINE SYNTHASE
    4e-14  11%  3bwcB  [x.x.x] SPERMIDINE SYNTHASE
    4e-14  10%  3c3pB  [x.x.x] METHYLTRANSFERASE
    5e-14  11%  1aqjA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    5e-14   9%  2bm8A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    5e-14  11%  1e50Q  [b.2.5] CORE-BINDING FACTOR ALPHA SUBUNIT
    7e-14  12%  3eeyA  [x.x.x] PUTATIVE RRNA METHYLASE
    7e-14  12%  3e05E  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    1e-13   9%  1admA  [x.x.x] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    1e-13  11%  3b5iA  [x.x.x] S-ADENOSYL-L-METHIONINE:SALICYLIC ACID CARBOXYL
    1e-13  12%  3e05A  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    2e-13  10%  3e05D  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    2e-13  10%  2br3D  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    2e-13  12%  3cvoA  [x.x.x] METHYLTRANSFERASE-LIKE PROTEIN OF UNKNOWN
    3e-13  15%  3c0kA  [x.x.x] UPF0064 PROTEIN YCCW
    3e-13  18%  3cjqD  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    3e-13  12%  3bwmA  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    4e-13   9%  2ckdA  [x.x.x] PUTATIVE METHYLTRANSFERASE
    4e-13   7%  3a17B  [x.x.x] ALDOXIME DEHYDRATASE
    5e-13   9%  3bgvD  [x.x.x] MRNA CAP GUANINE-N7 METHYLTRANSFERASE
    5e-13  11%  1aqiA  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    6e-13  10%  2br3B  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    6e-13  13%  3e05H  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    6e-13  15%  3egiD  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    6e-13  17%  3egiA  [x.x.x] TRIMETHYLGUANOSINE SYNTHASE HOMOLOG
    6e-13  14%  3e05C  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    7e-13  12%  3duwA  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    8e-13  13%  2b25A  [x.x.x] HYPOTHETICAL PROTEIN
    1e-12  12%  1cmoA  [b.2.5] POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
    1e-12  13%  2aztA  [x.x.x] GLYCINE N-METHYLTRANSFERASE
    1e-12  15%  3cggA  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    1e-12  13%  3cc8A  [x.x.x] PUTATIVE METHYLTRANSFERASE
    2e-12  12%  2cwwB  [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE
    2e-12  19%  3cjqA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    2e-12  12%  3d2lC  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    2e-12  11%  3dh0A  [x.x.x] SAM DEPENDENT METHYLTRANSFERASE
    3e-12   7%  3a15B  [x.x.x] ALDOXIME DEHYDRATASE
    3e-12  12%  1e50A  [b.2.5] CORE-BINDING FACTOR ALPHA SUBUNIT
    3e-12  17%  3bkwB  [x.x.x] S-ADENOSYLMETHIONINE DEPENDENT METHYLTRANSFERASE
    3e-12  15%  3e05F  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    4e-12  11%  2br3A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    4e-12  11%  2br4A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    4e-12  14%  2b3tA  [x.x.x] PROTEIN METHYLTRANSFERASE HEMK
    5e-12   7%  2dpmA  [c.66.1] PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE
    5e-12  14%  3e23A  [x.x.x] UNCHARACTERIZED PROTEIN RPA2492
    5e-12  13%  3bwcA  [x.x.x] SPERMIDINE SYNTHASE
    6e-12   9%  1aqjB  [c.66.1 - d.287.1] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
    7e-12  17%  3c6kD  [x.x.x] SPERMINE SYNTHASE
    8e-12  13%  1eanA  [b.2.5] RUNT-RELATED TRANSCRIPTION FACTOR 1
    8e-12  12%  2cwwA  [x.x.x] PUTATIVE SAM-DEPENDENT RNA METHYLTRANSFERASE
    1e-11  19%  3cjqG  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    1e-11  10%  2br3F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    1e-11  14%  3ckkA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    1e-11  10%  3dulA  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    2e-11  11%  3dh0B  [x.x.x] SAM DEPENDENT METHYLTRANSFERASE
    2e-11  12%  3eeyC  [x.x.x] PUTATIVE RRNA METHYLASE
    3e-11  12%  1eg2A  [c.66.1] MODIFICATION METHYLASE RSRI
    3e-11   9%  2ar0B  [x.x.x] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN
    4e-11  11%  1co1A  [b.2.5] CORE BINDING FACTOR ALPHA
    5e-11  14%  2br5F  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    5e-11  14%  1eizA  [c.66.1] FTSJ
    7e-11  12%  2d16A  [x.x.x] HYPOTHETICAL PROTEIN PH1918
    9e-11  19%  3cjtG  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    9e-11  11%  3bwyA  [x.x.x] COMT PROTEIN
    9e-11  11%  1booA  [c.66.1] PROTEIN (N-4 CYTOSINE-SPECIFIC METHYLTRANSFERASE
    9e-11  11%  3eeyF  [x.x.x] PUTATIVE RRNA METHYLASE
    1e-10  14%  3dtnB  [x.x.x] PUTATIVE METHYLTRANSFERASE MM_2633
    1e-10  12%  2avnA  [x.x.x] UBIQUINONE/MENAQUINONE BIOSYNTHESIS
    1e-10  16%  3dxzA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    1e-10  12%  2ekmA  [x.x.x] HYPOTHETICAL PROTEIN ST1511
    2e-10  14%  2br5C  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    3e-10  11%  3dulB  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    3e-10  12%  3eeyG  [x.x.x] PUTATIVE RRNA METHYLASE
    3e-10  14%  2br5A  [x.x.x] CEPHALOSPORIN HYDROXYLASE CMCI
    4e-10  14%  3cbgA  [x.x.x] O-METHYLTRANSFERASE
    5e-10  17%  3dr5A  [x.x.x] PUTATIVE O-METHYLTRANSFERASE
    6e-10  14%  3dtnA  [x.x.x] PUTATIVE METHYLTRANSFERASE MM_2633
    6e-10  13%  2cl5B  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    6e-10  12%  2cl5A  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    6e-10  11%  2bt8A  [x.x.x] SIGMA C
    1e-09  12%  1af7A  [x.x.x] CHEMOTAXIS RECEPTOR METHYLTRANSFERASE CHER
    1e-09  20%  3c6kC  [x.x.x] SPERMINE SYNTHASE
    2e-09  24%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    3e-09  17%  3cjrA  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    4e-09  11%  2bzgA  [x.x.x] THIOPURINE S-METHYLTRANSFERASE
    5e-09  17%  3dxyA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    5e-09  12%  2d16B  [x.x.x] HYPOTHETICAL PROTEIN PH1918
    6e-09  18%  3dxxA  [x.x.x] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE
    1e-08  15%  1e50C  [b.2.5] CORE-BINDING FACTOR ALPHA SUBUNIT
    2e-08  12%  1eaoA  [b.2.5] RUNT-RELATED TRANSCRIPTION FACTOR 1
    2e-08  12%  2avdA  [x.x.x] CATECHOL-O-METHYLTRANSFERASE
    3e-08   9%  2ckdB  [x.x.x] PUTATIVE METHYLTRANSFERASE
    3e-08  13%  1bc5A  [a.58.1 - c.66.1] CHEMOTAXIS RECEPTOR METHYLTRANSFERASE
    4e-08  16%  3douA  [x.x.x] RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J
    4e-08  17%  3cjtC  [x.x.x] RIBOSOMAL PROTEIN L11 METHYLTRANSFERASE
    3e-07  12%  3d2lA  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    5e-07  15%  3a27A  [x.x.x] UNCHARACTERIZED PROTEIN MJ1557
    7e-07  11%  1e50E  [b.2.5] CORE-BINDING FACTOR ALPHA SUBUNIT
    4e-05  22%  3dmfA  [x.x.x] PROBABLE RIBOSOMAL RNA SMALL SUBUNIT
:418

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKKVVLNFTDEAAMQEIAADPALKLAEMYMEGRAKVA
2eg5A           ----------------------------------------------------------------------
3dp7A           ----------------------------------------YTLQEISGRTGLTRYA----AQVLLEASLT
2aowA           ----------------------------------------------------------------------
3busA           ----------------------------------------------------------------------
1dl5A           ----------------------------------------------------------------------
3e7pA           ----------------------------------------------------------------------
3bwbA           ----------------------------------------------------------------------
2eg5E           ----------------------------------------------------------------------
3bgvA           ----------------------------------------------------------------------
1dl5B           ----------------------------------------------------------------------
3busB           ----------------------------------------------------------------------
2as0A           ----------------------------------------------------------------------
2an4A           ----------------------------------------------------------------------
1d2gA           ----------------------------------------------------------------------
3bgvB           ----------------------------------------------------------------------
2an3B           ----------------------------------------------------------------------
2aotB           ----------------------------------------------------------------------
3b5iB           ----------------------------------------------------------------------
2an3A           ----------------------------------------------------------------------
3dlcA           ----------------------------------------------------------------------
2aztB           ----------------------------------------------------------------------
2dulA           ----------------------------------------------------------------------
2b2cA           ----------------------------------------------------------------------
2an4B           ----------------------------------------------------------------------
2bm8K           ----------------------------------------------------------------------
3bkxA           ----------------------------------------------------------------------
3c6kB           ----------------------------------------------------------------------
3dp7B           ----------------------------------------------------------------------
3egeA           ----------------------------------------------------------------------
2a14A           ----------------------------------------------------------------------
1bhjA           ----------------------------------------------------------------------
1d2hA           ----------------------------------------------------------------------
3b3gA           ----------------------------------------------------------------------
2e5wA           ----------------------------------------------------------------------
2b25B           ----------------------------------------------------------------------
1dusA           ----------------------------------------------------------------------
3c6kA           ----------------------------------------------------------------------
3ccfA           ----------------------------------------------------------------------
2aotA           ----------------------------------------------------------------------
3c6mA           ----------------------------------------------------------------------
3c6mB           ----------------------------------------------------------------------
2cmgA           ----------------------------------------------------------------------
3bwbB           ----------------------------------------------------------------------
3c6mD           ----------------------------------------------------------------------
3b3fA           ----------------------------------------------------------------------
3bgvC           ----------------------------------------------------------------------
2bh2A           ------------------------------------------KQCPILAPQLEALLPKVRACLGSLQAMR
3e8sA           ----------------------------------------------------------------------
2ejuA           ----------------------------------------------------------------------
3e05B           ----------------------------------------------------------------------
2e58D           ----------------------------------------------------------------------
3dliA           ----------------------------------------------------------------------
2e58B           ----------------------------------------------------------------------
2b9eA           ----------------------------------------------------------------------
3bkwA           ----------------------------------------------------------------------
2bm9B           ----------------------------------------------------------------------
3c3yA           ----------------------------------------------------------------------
2br5D           ----------------------------------------------------------------------
3e05G           ----------------------------------------------------------------------
3egiB           ----------------------------------------------------------------------
2bh2B           ----------------------------------------------------------------------
2aouB           ----------------------------------------------------------------------
3ccfB           ----------------------------------------------------------------------
1dctA           ----------------------------------------------------------------------
3c3pA           ----------------------------------------------------------------------
3bzbA           ----------------------------------------------------------------------
3cjtA           ----------------------------------------------------------------------
3a25A           ----------------------------------------------------------------------
3bzbB           ----------------------------------------------------------------------
3cggB           ----------------------------------------------------------------------
2br5E           ----------------------------------------------------------------------
3bgdA           ----------------------------------------------------------------------
3eeyB           ----------------------------------------------------------------------
2e5wB           ----------------------------------------------------------------------
2bm8B           ----------------------------------------------------------------------
2admA           ----------------------------------------------------------------------
1cmvB           ---------------------------------------------------------VAPVYVGG-----
3bxoA           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
3a17D           ----------------------------------------------------------------------
3eeyI           ----------------------------------------------------------------------
2br4F           ----------------------------------------------------------------------
2e58A           ----------------------------------------------------------------------
3bt7A           ----------------------------------------------------------------------
2bm8G           ----------------------------------------------------------------------
3c6mC           ----------------------------------------------------------------------
3bwcB           ----------------------------------------------------------------------
3c3pB           ----------------------------------------------------------------------
1aqjA           ----------------------------------------------------------------------
2bm8A           ----------------------------------------------------------------------
1e50Q           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
3e05E           ----------------------------------------------------------------------
1admA           ----------------------------------------------------------------------
3b5iA           ----------------------------------------------------------------------
3e05A           ----------------------------------------------------------------------
3e05D           ----------------------------------------------------------------------
2br3D           ----------------------------------------------------------------------
3cvoA           ----------------------------------------------------------------------
3c0kA           ----------------------------------------------------------------------
3cjqD           ----------------------------------------------------------------------
3bwmA           ----------------------------------------------------------------------
2ckdA           ----------------------------------------------------------------------
3a17B           ----------------------------------------------------------------------
3bgvD           ----------------------------------------------------------------------
1aqiA           ----------------------------------------------------------------------
2br3B           ----------------------------------------------------------------------
3e05H           ----------------------------------------------------------------------
3egiD           ----------------------------------------------------------------------
3egiA           ----------------------------------------------------------------------
3e05C           ----------------------------------------------------------------------
3duwA           ----------------------------------------------------------------------
2b25A           ----------------------------------------------------------------------
1cmoA           ----------------------------------------------------------------------
2aztA           ----------------------------------------------------------------------
3cggA           ----------------------------------------------------------------------
3cc8A           ----------------------------------------------------------------------
2cwwB           ------------------------------------------VAALLENLAQALARREAVLRQDPEGYRL
3cjqA           ----------------------------------------------------------------------
3d2lC           ----------------------------------------------------------------------
3dh0A           ----------------------------------------------------------------------
3a15B           ----------------------------------------------------------------------
1e50A           ----------------------------------------------------------------------
3bkwB           ----------------------------------------------------------------------
3e05F           ----------------------------------------------------------------------
2br3A           ----------------------------------------------------------------------
2br4A           ----------------------------------------------------------------------
2b3tA           ----------------------------------------------------------------------
2dpmA           ----------------------------------------------------------------------
3e23A           ----------------------------------------------------------------------
3bwcA           ----------------------------------------------------------------------
1aqjB           ----------------------------------------------------------------------
3c6kD           ----------------------------------------------------------------------
1eanA           ----------------------------------------------------------------------
2cwwA           ------------------------------------------VAALLENLAQALARREAVLRQDPEGGYR
3cjqG           ----------------------------------------------------------------------
2br3F           ----------------------------------------------------------------------
3ckkA           ----------------------------------------------------------------------
3dulA           ----------------------------------------------------------------------
3dh0B           ----------------------------------------------------------------------
3eeyC           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
2ar0B           ----------------------------------VAKLWKLCDNLRDGGVSYQNYVNELASLLFLKCK--
1co1A           ----------------------------------------------------------------------
2br5F           ----------------------------------------------------------------------
1eizA           ----------------------------------------------------------------------
2d16A           ----------------------------------------------------------------------
3cjtG           ----------------------------------------------------------------------
3bwyA           ----------------------------------------------------------------------
1booA           ----------------------------------------------------------------------
3eeyF           ----------------------------------------------------------------------
3dtnB           ----------------------------------------------------------------------
2avnA           ----------------------------------------------------------------------
3dxzA           ----------------------------------------------------------------------
2ekmA           ----------------------------------------------------------------------
2br5C           ----------------------------------------------------------------------
3dulB           ----------------------------------------------------------------------
3eeyG           ----------------------------------------------------------------------
2br5A           ----------------------------------------------------------------------
3cbgA           ----------------------------------------------------------------------
3dr5A           ----------------------------------------------------------------------
3dtnA           ----------------------------------------------------------------------
2cl5B           ----------------------------------------------------------------------
2cl5A           ----------------------------------------------------------------------
2bt8A           ----------------------------------------------------------------------
1af7A           --------------------------------------------------------------MTQRLALS
3c6kC           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
3cjrA           ----------------------------------------------------------------------
2bzgA           ----------------------------------------------------------------------
3dxyA           ----------------------------------------------------------------------
2d16B           ----------------------------------------------------------------------
3dxxA           ----------------------------------------------------------------------
1e50C           ----------------------------------------------------------------------
1eaoA           ----------------------------------------------------------------------
2avdA           ----------------------------------------------------------------------
2ckdB           ----------------------------------------------------------------------
1bc5A           --------------------------------------------------------------MTQRLALS
3douA           ----------------------------------------------------------------------
3cjtC           ----------------------------------------------------------------------
3d2lA           ----------------------------------------------------------------------
3a27A           ----------------------------------------------------------------------
1e50E           ----------------------------------------------------------------------
3dmfA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KGDIYDFLALVKGNTLSEALSFGMIWRGMARIIAARIKMRLPVNHNKSNVAHHYDLSAKLFDLFLDEDWQ
2eg5A           ----------------------------------------NKCIKVADLGCASGPNTLLTVRDIVQSIDK
3dp7A           IGTILEEDRYVLAKAGWFLLNDKMARVNMEFNHDVNYQGLFHLEEALLNGRPEGLKVFGEWPTIYEGLSQ
2aowA           ------------------------------------------------------------------ESFR
3busA           ----------------------------------------------------------------------
1dl5A           ------------------------------------------------EIPREEFLTKSYPLSYVYEDIV
3e7pA           -------------------------------------------------------------NTILGFDVN
3bwbA           --------ELISGGWFREENDQ---WPGQASLRVEKVLYDAPTKFQHLTIFESDPKG-PWGTVALDGCIQ
2eg5E           -----------------------------------ELLRANLPNINKCIKVADLASGPNTLLTVRDIVQS
3bgvA           ----------------------------------------------------------------------
1dl5B           ------------------------------------------------EIPREEFLTKSYPLSYVYEDIV
3busB           ---------------------------------------------------------------------N
2as0A           -------------------------KLDVAEAIEVEPGIETVFEKNTGRSRPEIERVLLGKEKYRTIIQE
2an4A           --------------------------------------------------ASAYQRFEP--RAYLRNNYA
1d2gA           -----------------------------------------------SLGVAAEGIPDQYAD-------G
3bgvB           ----------------------------------------------------------------------
2an3B           -------------------------------------------APGQAAVASAYQRFEP--RAYLRNNYA
2aotB           -----------------------------------------------RSLFSDHGKYVESFRRFLNHSTE
3b5iB           -------------------------------------------------IDFIVKHISKRFDAAGIDPPE
2an3A           -------------------------------------------------VASAYQRFEP--RAYLRNNYA
3dlcA           ----------------------------------------------------------------------
2aztB           ---------------------------------------------------------------------G
2dulA           --------------------------------------------------------------------VQ
2b2cA           ----------------------------------------------LQVKKVLFHEKSKYQDVLVFESTT
2an4B           --------------------------------------------PGQAAVASAYQRFEP--RAYLRNNYA
2bm8K           -----------------------------------FQDLNLFRGLGEDPAYHPPVLTDRPRDWPLDRDLG
3bkxA           --------------------------------------------------------------------IT
3c6kB           --------------------------------------------YQNIKILHSKQFG---NILILSGDVN
3dp7B           --------------------------------------------EALLNGRPEGLKVFGEWPTIYEGLSQ
3egeA           ----------------------------------------------------------------------
2a14A           ------------------------------------------------------------YQKHFLPRDY
1bhjA           -----------------------------------------------SLGVAAEGIPDQYAD-------G
1d2hA           ----------------------------------------------------------------------
3b3gA           ----------------------------------------------------------------------
2e5wA           --------------------------------------------VAFKVKRKILEEQSEYQKIEVYETEG
2b25B           -----------------------------------QAGELILAETKFKKLFRLNKIVGKFPGQILRSQYM
1dusA           --------------------------------------------------------------IVEDILRG
3c6kA           --------------------------------------------YQNIKILHSKQFGN---ILILSGDVN
3ccfA           ----------------------------------------------------------------------
2aotA           -----------------------------------------------------------MRSLFSDHGKY
3c6mA           --------------------------------------------YQNIKILHSKQFGN---ILILSGDVN
3c6mB           --------------------------------------------YQNIKILHSKQFG---NILILSGDVN
2cmgA           ------------------------------------------------IEAKLLDVRSEHNILEIFKSKD
3bwbB           -------------------------WPGQASLRVEKVLYDAPTKFQHLTIFESDPK-GPWGTVALDGCIQ
3c6mD           --------------------------------------------YQNIKILHSKQFGN---ILILSGDVN
3b3fA           ---------------------------------------------------------------------F
3bgvC           ----------------------------------------------------------------------
2bh2A           HLGHVELVQATSGTLMILRHTAPLSSADREKLERFSHSEGLDLYLAPDSEILETVSGEMPWYDSNGLRLT
3e8sA           -------------------------------------------NPEDA-LLDSWHQNAQAWIDAVRHGA-
2ejuA           ------------------------------------------------------------------EGKA
3e05B           ----------------------------------------------------------------------
2e58D           ------------------------------EEFNVILREFLRFAYNPEESGQEIADTADGSKTLIHKTYG
3dliA           ----------------------------------------------------------------------
2e58B           ------------------------------EEFNVILREFLRFAYNPEESGQEIADTADGSKTLIHKTYG
2b9eA           -------------------------------------------------KHFLLDPLMPELLVFPAQTDL
3bkwA           ----------------------------------------------------------------------
2bm9B           -----------------------------------FQDLNLFRGLGEDPAYHPPVLTDRPRDWPLDRDLG
3c3yA           ----------------------------------------------QSEELCQYILRTSVY-PREAGFLK
2br5D           -------------------------------------------------AYHPPVLTDRPRDWPLDRDLG
3e05G           ----------------------------------------------------------------------
3egiB           -------------------------------------------------------LGSRLFSRFDDGIKL
2bh2B           -------------------------------------------YLAPDSEILETVSGEMPWYDSNGLRLT
2aouB           -----------------------------------------------RSLFSDHGKYVESFRRFLNHSTE
3ccfB           ----------------------------------------------------------------------
1dctA           ----------------------------------------------------------------------
3c3pA           ---------------------------------------------------------GAYLDGLLPEADP
3bzbA           ----------------------------------------------------------------VERYQS
3cjtA           -------------------------------------------------LAPWHTWEGAEIPLVIEPGMA
3a25A           ----------------------------------------------------------------------
3bzbB           ---------------------------------------------------------------------P
3cggB           -------------------------------------------------------------------NPA
2br5E           -----------------------------------FQDLNLFRGLGEDPAYHPPVLTDRPRDWPLDRDLG
3bgdA           ------------------------------------------------------------------LTLE
3eeyB           ----------------------------------------------------------------------
2e5wB           ------------------------------------------------VKRKILEEQSEYQKIEVYETEG
2bm8B           -----------------------------------FQDLNLFRGLGEDPAYHPPVLTDRPRDWPLDRDLG
2admA           ----------------------------------------------------------------------
1cmvB           ------FLARYDQSPDEAEL------LLPRDVVEHWLHAALPLNINHDDVAAMQSVRDGLFCLGCVTSPR
3bxoA           ---------------------------------------------------------------EVDHADV
3c3pC           ---------------------------------------------------------GAYLDGLLPEADP
3a17D           ----------------------------------GEINEHGYWGSMRERFPISQTDWMQASGELRVIAGD
3eeyI           ----------------------------------------------------------------------
2br4F           -------------------------------------------------AYHPPVLTDRPRDWPLDRDLG
2e58A           ------------------------------------------------RFAYNPEESGQEIADTADGSKT
3bt7A           -----------------------------------LNVHLIGRATKTKIELDQDYIDERLPVAGKEMIYR
2bm8G           -----------------------------------FQDLNLFRGLGEDPAYHPPVLTDRPRDWPLDRDLG
3c6mC           --------------------------------------------YQNIKILHSKQFGNILIL---SGDVN
3bwcB           --------------------------------------------FQHLTIFESDPK-GPWGTVALDGCIQ
3c3pB           ---------------------------------------------------------GAYLDGLLPEADP
1aqjA           ----------------------------------------------------------------------
2bm8A           ----------------------------------------------EDPAYHPPVLTDRPRDWPLDRDLG
1e50Q           ----------------------------------------------------------------------
3eeyA           ----------------------------------------------------------------------
3e05E           ---------------------------------------------------------------------Q
1admA           ----------------------------------------------------------------------
3b5iA           ----------------------------------------------------------------------
3e05A           ---------------------------------------------------------------------Q
3e05D           ----------------------------------------------------------------------
2br3D           -------------------------------------------------AYHPPVLTDRPRDWPLDRDLG
3cvoA           ----------------------------------------------------------------------
3c0kA           ------------------------------------------------GELTQGPVTGELPPALLPIEEH
3cjqD           -------------------------------------------------LAPWHTWEGAEIPLVIEPGMA
3bwmA           --------------------------------------------------QRILNHVLQHAEPGNAQSVL
2ckdA           ----------------------------------------------------------------------
3a17B           -------------------------VGAVMDGISGEINEHGYWGSMRERFPISQTDWMQASGELRVIAGD
3bgvD           ----------------------------------------------------------------------
1aqiA           ----------------------------------------------------------------------
2br3B           ----------------------------------------------EDPAYHPPVLTDRPRDWPLDRDLG
3e05H           --------------------------------------------------------------LAQYPVIG
3egiD           ----------------------------------------------------------------LGSRL-
3egiA           -------------------------------------------------------LGSRLFSRFDDGIKL
3e05C           ---------------------------------------------------------------------Q
3duwA           -------------------------------------------------IETWTAVDQYVSDVLIPKDST
2b25A           ----------------------------------------------GKFPGQILRSSFGKQYMLRRPALE
1cmoA           ----------------------------------------------------------------------
2aztA           ---------------------------------------------------------------------G
3cggA           ------------------------------------------------------------------DNNP
3cc8A           ----------------------------------------------------------------------
2cwwB           VHAEGDLLPGLVVDYYAGHAVVQATAHAWEGLLPQVAEALRPHVQSVLAKNDARTRELEGLPLYVRPLLG
3cjqA           -------------------------------------------------LAPWHTWEGAEIPLVIEPGMA
3d2lC           ----------------------------------------------------------------------
3dh0A           ----------------------------------------------------------------------
3a15B           -------------------------------------------GSMRERFPISQTDWMQASGELRVIAGD
1e50A           ----------------------------------------------------------------------
3bkwB           ----------------------------------------------------------------------
3e05F           ---------------------------------------------------------------------Q
2br3A           -------------------------------------------------AYHPPVLTDRPRDWPLDRDLG
2br4A           -------------------------------------------------AYHPPVLTDRPRDWPLDRDLG
2b3tA           --------------------------------------------------TRRRDGEPIAHLTGVREFWS
2dpmA           ---------------------------------------DAVINDFNAELINCYQQIKDNPQELIEILKV
3e23A           --------------------------------------------------------------------DD
3bwcA           -------------------------WPGQASLRVEKVLYDAPTKFQHLTIFESDPKGPWGT-VALDGCIQ
1aqjB           ----------------------------------------------------------------------
3c6kD           --------------------------------------------YQNIKILHSKQFGNILI---LSGDVN
1eanA           ----------------------------------------------------------------------
2cwwA           LVHAEGDLLPYYAGHAVVQATAHAWEGLLPQVAEALRPHVQSVLAKNDARTRELEGLPLYVRPLLGEVPE
3cjqG           -------------------------------------------------LAPWHTWEGAEIPLVIEPGMA
2br3F           -------------------------------------------------AYHPPVLTDRPRDWPLDRDLG
3ckkA           ----------------------------------------------------------------------
3dulA           ---------------------------------------------------DVLIPKDSTLEEVLQVNAA
3dh0B           ----------------------------------------------------------------------
3eeyC           ----------------------------------------------------------------------
1eg2A           -------------------------------------------------------------RNPTNVWRM
2ar0B           --ETGQEAEYLPEGYRWDDLKSRIGQEQLQFYRKLVHLGEDDKKLVQAVFHNVSTTITEPKQITALVSND
1co1A           ----------------------------------------------------------------------
2br5F           --------------------------------------------------YHPPVLTDRPRDWPLDRDLG
1eizA           ----------------------------------------------------------------------
2d16A           ----------------------------------------------------------------------
3cjtG           -------------------------------------------------LAPWHTWEGAEIPLVIEPGGT
3bwyA           -------------------------------------------------EQRILNHVLQHAEPGNAQSVL
1booA           --------------------VNKRKIRVKDAVNTVWWFSKTEWPKSDITKVLASIPPNLLQISNSESNGQ
3eeyF           ----------------------------------------------------------------------
3dtnB           ----------------------------------------------------------------------
2avnA           ---------------------------------------------HKLRSWEFYDRIARAYDSYETPKWK
3dxzA           ----------------------------------------------------------------------
2ekmA           ----------------------------------------------------------------------
2br5C           -------------------------------------------------AYHPPVLTDRPRDWPLDRDLG
3dulB           ---------------------------------------------------DVLIPKDSTLEEVLQVNAA
3eeyG           ----------------------------------------------------------------------
2br5A           -------------------------------------------------AYHPPVLTDRPRDWPLDRDLG
3cbgA           ----------------------------------------------------ITGFDPSLYSYLQADDSF
3dr5A           ----------------------------------------------------------------------
3dtnA           ---------------------------------------------------------------------A
2cl5B           ----------------------------------------------EQRILRYVQQNAKPGD---PQSVL
2cl5A           ----------------------------------------------KEQRILRYVQQNA--KPGDPQSVL
2bt8A           ----------------------------------------------------------------------
1af7A           DAHFRRICQLIYQRA-------GIVLADHKRDMVYNRLVRRLRALGLDDFGRYLS---MLEANQNSAEWQ
3c6kC           --------------------------------------------------------------LILSGDVN
2eg5G           ----------------------------------------------------------------------
3cjrA           ----------------------------------------------------------------------
2bzgA           ---------------------------------------------------------------NQVLTLE
3dxyA           ----------------------------------------------------------------------
2d16B           ----------------------------------------------------------------------
3dxxA           ----------------------------------------------------------------------
1e50C           ----------------------------------------------------------------------
1eaoA           ----------------------------------------------------------------------
2avdA           -----------------------------------------------SRSMREHPALRSLRLLTLEQPQ-
2ckdB           ----------------------------------------------------------------------
1bc5A           DAHFRRICQLIYQRA---GIVLADHKRDMVY---NRLVRRL-RALGLDDFGRYLS---MLEANQNSAEWQ
3douA           ----------------------------------------------------------------------
3cjtC           ----------------------------------------------------------------------
3d2lA           ----------------------------------------------------------------------
3a27A           ----------------------------------------------------------HVKILYGKETET
1e50E           ----------------------------------------------------------------------
3dmfA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YSCAYFNPPDIGLYEAQVAKKRHIAAKLMTEPGQSVLEIGSGWGGMAMYIAESAGADVTGITLSEEQLRV
2eg5A           VGQLERPTIQIFLNDLFPNDFNSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHS
3dp7A           LPEQVQKSWFGFDHFYSDQSFGKALEIVFSHHPKRLLDIGGNTGKWATQCVQYNKEVEVTIVDLPQQLEM
2aowA           RFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEP
3busA           HFGYWEDAGADVSVDDATDRLTDEIALLDVRSGDRVLDVGCGIGKPAVRLATARDVRVTGISISRPQVNQ
1dl5A           LV--SYDDGEEYSTSSQPSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVKGLVVSVEYSRKICEI
3e7pA           LICDFFLNTERQGPGSPEVTLKALSFIDNLTNKSLIADLGCGTGGQTMILAQHVPGKITGIDFFPGFIER
3bwbA           VTDYD--------EFVYHEVLGHTSLCSHPKP-ERVLIIGGGDGGVLREVLHGTVEHCDLVDIDGEVEQS
2eg5E           IDVGQLERPTIQLNDLFPNDFNSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSSRLFPEESMHFLHSCY
3bgvA           ----------------KSVLIGEFLEKVRQKKDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQ
1dl5B           LV--SYDDGEEYSTSSQPSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVKGLVVSVEYSRKICEI
3busB           LHFGYWESVDD-----ATDRLTDEIALLDVRSGDRVLDVGCGIGKPAVRLATARDVRVTGISISRPQVNQ
2as0A           GRAKFIVDRGQKTGFFLDQRENRLALEKWVQPGDRVLDVFTYTGGFAIHAAIAGADEVIGIDKSPRAIET
2an4A           PPRGDLCNPNGVGPWKLRC--LAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQE
1d2gA           EAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVE-EGFSVTSVDASDKMLKY
3bgvB           ------FYLRNFNNWMKSVLIGEFLEKVRQKKDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQ
2an3B           PPRGDLC--NPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQE
2aotB           H--------QCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVINNEVVKTS
3b5iB           FTAFFSDLPS----NDFNTLFQLLPPLVSNDGNRSYFVAGVPGSFYRRLFPAR-TIDFFHSAFSLHWLSQ
2an3A           PPRGDLCNPNGVGPWKLRC--LAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQE
3dlcA           ---------------------AENIINRFGITAGTCIDIGSGPGALSIALAKQSDFSIRALDFSKHNEIA
2aztB           EAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLV-EEGFSVTSVDASDKMLKY
2dulA           EGKAKILIPPVFYNPRMALNRDIVVVLLNILNPKIVLDALSATGIRGIRFALTPAEEVWLNDISEDAYEL
2b2cA           YGNVLVLDGIVQATEFSYQEMLAHLPMFAHPDPKRVLIIGGGDGGILREVLKHEVEKVTMCEIDEMVIDV
2an4B           PPRGDLC--NPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQE
2bm8K           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
3bkxA           DLALGPTANARTIQRRQTAHRLAIAEAWQVKPGEKILEIGCGQGDLSAVLADQVSGHVTGIDIASPDYGA
3c6kB           LAESDLAY-----------TRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDG
3dp7B           LPEQVQKSWFGFDHFYSDQSFGKALEIVFSHHPKRLLDIGGNTGKWATQCVQYNKEVEVTIVLPQQLEMM
3egeA           -------------RVPDIRIVNAIINLLNLPKGSVIADIGAGTGGYSVALANQGL-FVYAVEPSIVRQQA
2a14A           LATYYSFDGSPSPEAEMLKFNLECLHKTFGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREE
1bhjA           EAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVE-EGFSVTSVDASDKMLKY
1d2hA           ---------------------AWLLGLLRQHGCHRVLDVACGTGVDSIMLVE-EGFSVTSVDASDKMLKY
3b3gA           ---GYLSQQQNMMYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQH
2e5wA           FGKLLAIDGLVTEGEKSYHEPLVHPAMLAHPNPRRVLIIGGGDGGAIREVLKHEEVEAKYIGIDGGILEK
2b25B           LRRPALVLMKRGTAITFPKDINMILSMMDINPGDTVLEAGSGSGGMSLFLSKAVQGRVISFEVRKDHHDL
1dusA           KKLKFKTDSGVFSYGKVDKGTKILVENVVVDKDDDILDLGCGYGVIGIALAD--EVKSTTADINRRAIKL
3c6kA           LAESDLAY-----------TRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDG
3ccfA           ----------------VWQYGEDLLQLLNPQPGEFILDLGCGTGQLTEKIAQ-SGAEVLGTDNAATIEKA
2aotA           VESFRRFLNQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEP
3c6mA           LAESDLAY-----------TRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDG
3c6mB           LAESDL-----------AYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDG
2cmgA           FGEIAMLNRQLKNFLHIESELLAHMGGCTKKELKEVLIVDGFDLELAHQLF-KYDTHIDFVQADEKILDS
3bwbB           VTDYDE--------FVYHEVLGHTSLCSHPKP-ERVLIIGGGDGGVLREVLHGTVEHCDLVDIDGEVEQS
3c6mD           LAESDLAY-----------TRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDG
3b3fA           YGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQH
3bgvC           --------------------MKSVLIGEFLEKVRQKRDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQ
2bh2A           FSPRDF---IQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLAT-QAASVVGVEGVPALVEK
3e8sA           ------------IESRRQVTDQAILLAILGRQPERVLDLGCGEGWLLRALAD-RGIEAVGVDGDRTLVDA
2ejuA           KILIPKADSPVFYNPRMALNRDIVVVLLNILNPKIVLDALSATGIRGIRFALETPAEVWLNDISEDAYEL
3e05B           IGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPGRIFALERNPQYLG-
2e58D           EPYHSQTAGAIRESLYKFVRPSRILEKAKERKVIRILDVGFGLGYNLAVALKHLWEVVEIISFEKELLKE
3dliA           ----YYFLFEEKFRGSRELVKARLRRYIPFKGCRRVLDIGCGRGEFLELCKEEGI-ESIGVDINEDMIKF
2e58B           EPYHSQTAGAIRESLYKFVRPSRILEKAKERKVIRILDVGFGLGYNLAVALKHLWERVEIISFEKELLKE
2b9eA           HEHPLYRA---GHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLQGKIFAFDLDAKRLAS
3bkwA           ------------------AAEWPALRALPEVGGLRIVDLGCGFGWFCRWAHEHGASYVLGLDLSEKL---
2bm9B           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
3c3yA           ELREANESHPDSYMSTSPLAGQLMSFVLKLVNAKKTIEVGVFTGYSLLLTALSIDGKITAIDFDREAYEI
2br5D           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
3e05G           YPVIGIDDDTAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNGRIFALERNPQYLG
3egiB           DREGWFSVTP------EKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFAL--TGRVIAIDIDPVKIAL
2bh2B           FSPRDF---IQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLAT-QAASVVGVEGVPALVEK
2aouB           HQCMQE--------FMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSK-VQAQYPGVINNEVVEP
3ccfB           --------------SFVWQYGEDLLQLLNPQPGEFILDLGCGTGQLTEKI-AQSGAEVLGT--------D
1dctA           ----------------------------------NLISLFSGAGGLDLGFQKAGFRIICANEYDKSIWKT
3c3pA           VVAAEQIARERNIPIVDRQTGRLLYLLARIKQPQLVVVPGDGLGCASWWFARAISISSRVVIDPDRDNVE
3bzbA           PAGAPQCSVQVQTTSGARALADTLCWQPELIAGKTVCELGAGAGLVSIVAFLAGAQVVATDYPDPEILNS
3cjtA           FGTGHAETTRLALK----ALARHL------RPGDKVLDLGTGSGVLAIAAEK-LGGKALGVDIDPMVLPQ
3a25A           -------------------VKERVRMAKVAKPDELVVDMFAGIGHLSLPIAVYGKAKVIAIEKDPYTFKF
3bzbB           AGAPLQCSVQVQTTSGARALADTLCWQPELIAGKTVCELGAGAGLVSIVAFLAGADQVVATDYPDPEILN
3cggB           HSENYAQRWRN-LAAAGNDIYGEARLIDAAPRGAKILDAGCGQGRIGGYLSK-QGHDVLGTDLDPILIDY
2br5E           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
3bgdA           DWKEKWVTRHIHQEQGHQLLKKHLDTFLKGQSGLRVFFPLCGKAIEMKWFAD-RGHTVVGVEISEIGIRE
3eeyB           ------------LTIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVGENVFGFDIQDKAIAN
2e5wB           FGKLLAIDGTVTEGEKSYHEPLVHPAMLAHPNPRRVLIIGGGDGGAIREVLKHEEVEAKYIGIDGGILEK
2bm8B           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
2admA           ---------------------DFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGYRFVGVEIDPKALDL
1cmvB           FLEIVRRASEKSE--------LVSRGPVSPLQPDKVVEFLSGSYAGLSLSKHVAGRRRGTLAVYGRDPEW
3bxoA           YDLFYL---GRGKDYAAEASDIADLVRSRTPEASSLLDVACGTGTHLEHFTK-EFGDTAGLELSEDMLTH
3c3pC           VVAAEQIARERNIPIVDRQTGRLLYLLARIKQPQLVVVPGDGLGCASWWFARAISSSRVVIDPDRDNVEH
3a17D           PAVGGRVVVR-GHDNIALIRSGQDWADAEADERSLYLDEILPTLQSGMDFLR-DNGPAVGCYSNRFVRNI
3eeyI           ------------LTIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVGENVFGFDIQDKAIAN
2br4F           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
2e58A           LIHKTYGEPYHSQTAGKFVRPSRILEKAKERKVIRILDVGFGLGYNLAVALKNPKLRVEIISFEKELLKE
3bt7A           QVENSF----TQPNAAMNIQMLEWALDVTKGSKGDLLELYCGNGNFSLALAR-NFDRVLATEIAKPSVAA
2bm8G           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
3c6mC           LAESDLAY-----------TRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDG
3bwcB           VTDYDE--------FVYHEVLGHTSLCSHPKP-ERVLIIGGGDGGVLREVLRGTVEHCDLVDIDGEVEQS
3c3pB           VVAAEQIARERNIPIVDRQTGRLLYLLARIKQPQLVVVPGDGLCASWWFARAISISSRVVIDPDRDNVEH
1aqjA           ---------------------DFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGYRFVGVEIDPKALDL
2bm8A           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
1e50Q           ----------------------------------------------------------------------
3eeyA           ------------LTIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVGENVFGFDIQDKAIAN
3e05E           YPVIGIDDDTAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNGRIFALERNPQYLG
1admA           ---------------------DFMVSLAEAPRGGRVLEPACAHGPFLRAFREGTGYRFVGVEIDPKALDL
3b5iA           ---------RSMLHLLEETLENVHLNSSASPPPFTAVDLGCSSGANTVHIIDFIVFTAFFSDLPSNDFNT
3e05A           YPVIGIDDDTAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASN-LMPNGRIFALERNPQYL
3e05D           -----------KKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNGRIFALERNPQYL-
2br3D           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
3cvoA           ------------------------------EEAEVILEYGSGGSTVVAAELP--GKHVTSVESDRAWARK
3c0kA           GKL-LVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYTGGFAVSALG-GCSQVVSVDTSQEALDI
3cjqD           FGTGHHETTRLALK----ALARHL------RPGDKVLDLGTGSGVLAIAAEK-LGGKALGVDIDPMVLPQ
3bwmA           EAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARSPGARLITIEINPDCAAI
2ckdA           ------------YQAVRTNFFDTYFNNAVIDGIRQFVILASGLDSRAYRLDWPTGTTVYEIDQPKVLAYK
3a17B           PAVGGRVVVRGHDNIALIRSGQDWADAEA-DERSLYLDEILPTLQS-GMDFLRDNGPAVGCYSNRFVRNI
3bgvD           ----------FYLRNFNNWMKSVLIGEFLEKVRQKDITVGCGKGGDLLKWKKGRINKLVCTDIADVSVKQ
1aqiA           ---------------------DFMVSLAEAPRGGRVLEPACAHGPFLRAFREGTGYRFVGVEIDPKALDL
2br3B           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
3e05H           IDDDEFA--TAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNGRFALERNPQYLGF
3egiD           FSRFDDGREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFAL--TGRVIAIDIDPVKIAL
3egiA           DREGWFSVTPEKIAEHIAGRVSQSF------KCDVVVDAFCGVGGNTIQFA--LTGRVIAIDIDPVKIAL
3e05C           YPVIGIDDDTAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNGRIFALERNPQYLG
3duwA           LEEVLQVNANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARSSGGRVVTLEASEKHADI
2b25A           DYVVLM---KRGTAITFPKDINMILSMMDINPGDTVLEAGSGSGGMSLFLSKAVQGRVISFEVRKDHHDL
1cmoA           ----------------------------------------------------------------------
2aztA           EAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLV-EEGFSVTSVDASDKMLKY
3cggA           AHSENYAQRWRNLAAAGNDIYGEARLIDAAPRGAKILDAGCGQGRIGGYLSK-QGHDVLGTDLDPILIDY
3cc8A           ---------------------NPNLLKHIKKEWKEVLDIGCSSGALGAAIKEN-GTRVSGIEAFPEAAEQ
2cwwB           GRVRYLVDLRAGQKTGAYLDQRENRLYMERFRGERALDVFSYAGGFALHLAL-GFREVVAVDSSAEALRN
3cjqA           FGTGHHETTRLALK----ALARHL------RPGDKVLDLGTGSGVLAIAAEK-LGGKALGVDIDPMVLPQ
3d2lC           --------------ELQDVPYPEWVAWVLEQPGKRIADIGCGTGTATLLLAD-HYEVTGVDLSEELEIAQ
3dh0A           ------------PSRLELFDPEKVLKEFGLKEGMTVLDVGTGAGFYLPYLSKMVGEKGKVYAIDVQEEMV
3a15B           PAVGGRVVVRGHDNIALIRSGQDWA-DAEADERSLYLDEILPTLQSGMDFLR-DNGPAVGCYSNRFVRNI
1e50A           ----------------------------------------------------------------------
3bkwB           ----------------DGAAEWPALRALPEVGGLRIVDLGCGFGWFCRWAHEHGASYVLGLDLSEKL---
3e05F           YPVIGIDDDTAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNGIFALERNPQYLGF
2br3A           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
2br4A           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
2b3tA           LPL-FVSPATLIPRPDTECLVEQALARLPEQPCR-ILDLGTGTGAIALALASERDCEIIAVDRMPDAVSL
2dpmA           HQEYNSKEYYLDLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKN-QFNVPYGRYKNPKIVDE
3e23A           DTLRFYRGNATAYAERQPRSATLTKFLGELPAGAKILELGCGA--GYQAEALAAGFDVDATDGSPELAAE
3bwcA           VTDY--------DEFVYHEVLGHTSLCSHPKP-ERVLIIGGGDGGVLREVLHGTVEHCDLVDIDGEVEQS
1aqjB           ---------------------DFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGYRFVGVEIDPKALDL
3c6kD           LA------------ESDLAYTRAIMGSGKDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDG
1eanA           ----------------------------------------------------------------------
2cwwA           RVQVQEGRVRYLVDLGAYLDQRENRLYMERFRGERALDVFSYAGGFALHLAL-GFREVVAVDSSAEALRR
3cjqG           FGTGHHETTRLALK----ALARHL------RPGDKVLDLGTGSGVLAIAAEK-LGGKALGVDIDPMVLPQ
2br3F           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
3ckkA           ---------------------MDWSELYPEFAQVEFADIGCGYGGLLVELSPLFPDLILGLEIRVKVSDY
3dulA           A--------NLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLSGRVVTLEASEKHADI
3dh0B           ------------PSRLELFDPEKVLKEFGLKEGMTVLDVGTGAGFYLPYLSKMVGEKGKVYAIDVQEEMV
3eeyC           ------------LTIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVGENVFGFDIQDKAIAN
1eg2A           SRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQ-EGRNSICTDAAPVFKEY
2ar0B           SLDWQYFTPR--------PLIKTIIHLLKPQPREVVQDPAAGTAGFLIEADRYVHRAFIGLELVPGTRRL
1co1A           ----------------------------------------------------------------------
2br5F           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTKIMGIDCQVIGIDRDL
1eizA           --------------RAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQIGGKIIACDLLPMDPIV
2d16A           ---------DIEKPEGVEVIIGQGNFSIFTVDDLARALLTAVPGIKFGIAMNAKPQLTRYTGNDPELEAL
3cjtG           GHAETTRL-------ALKALARHL------RPGDKVLDLGTGSGVLAIAAEK-LGGKALGVDIDPMVLPQ
3bwyA           EAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSARLITIEINPDCAAI
1booA           YLANCKLMGIKAHPARFPAKLPEFFIRMLTEPDDLVVDIFGGSNTTGLVAER-ESRKWISFEMKPEYVAA
3eeyF           ------------LTIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVGENGFGFDIQDKAIAN
3dtnB           -SGKYDEQRRKFIPCFDDFYGVSVSIASVDTENPDILDLGAGTGLLSAFLMEKYPEAFTLVDMSEKMLEI
2avnA           LYHRLI---------------GSFLEEYLK-NPCRVLDLGGGTGKWSLFLQERG-FEVVLVDPSKELEVA
3dxzA           -------------MGVEFSEDMLDFPALFGREAPVTLEIGFGMGASLVAMAKRPEQDFLGIEVHSPGVGA
2ekmA           ----------------------GQSHFIKTVEDLYETLASSSPHLKFGIAFCEAKRLIRWDGNDEELIKL
2br5C           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTDCQVIGIDRDLSRCQI
3dulB           A--------NLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLSGRVVTLEASEKHADI
3eeyG           ------------LTIKNSLGQSHDYIKMFVKEGDTVVDATCGNGNDTAFLASLVGENVFGFDIQDKAIAN
2br5A           YSDFSPYQWRGLRMLKDPDTQAVYHDMLWELRPRTIVELGVYNGGSLAWFRDLTDCQVIGIDRDLSRCQI
3cbgA           YLAQLRRETAHAPMQISPEQAQFLGLLISLTGAKQVLEIGVFRGYSALAMALPPDGQIIACDQDPNATAI
3dr5A           -----------------------LAATTNGNGSTGAIAITPAAGLVGLYILNGLNTTLTCIDPESEHQRQ
3dtnA           VSGKYDEQRRKFIPCFDDFYGVSVSIASVDTENPDILDLGAGTGLLSAFLME-KYPEATFTLVDMSEKML
2cl5B           EAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARQPGARLLTMEMNPDYAAI
2cl5A           EAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGLLTMEMNPDYAAI
2bt8A           -----------GLSFSPPLSVADGVVSLDMDPYFCSQRVSLTSYSAEAQLMQGTNGSSDTIDMTVNAHCH
1af7A           AFINALTTNLTAFFREAHHFPILAEHARRRHGEYRVWSAAASTGEEPYSIAITLRWKVFASDIDTEVLEK
3c6kC           ------------LAESDLAYTRAIMGGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDG
2eg5G           ----------------------------------------------------------------------
3cjrA           -------------------------------PGDKVLDLGTGSGVLAIAAEK-LGGKALGVDIDPMVLPQ
2bzgA           EWQDKWGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEKWFADR--GHSVVGVEISELGIQE
3dxyA           -------------------------PALFGREAPVTLEIGFGMGASLVAMAKDPEQDFLGIEVHSPGVGA
2d16B           ---------DIEKPEGVEVIIGQGNFSIFTVDDLARALLTAVPGIKFGIAMNEAKPLTRYTGNDPELEAL
3dxxA           -------------------------PALFGREAPVTLEIGFGMGASLVAMAKDPEQDFLGIEVHSPGVGA
1e50C           ----------------------------------------------------------------------
1eaoA           ----------------------------------------------------------------------
2avdA           -----------GDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALAADGRVVTCEVDAQPPEL
2ckdB           ------------YQAVRTNFFDTYFNNAVIDGIRQFVILASGLDSRAYRLDWPTGTTVYEIDQPKVLAYK
1bc5A           AFINALTTNLTAFFREAHHFPILAEHARRRHGEYRVWSAAASTGEEPYSIAITLRWKVFASDIDTEVLEK
3douA           ---------------------FLLDRYRVVRKGDAVIEIGSSPGGWTQVLNS-LARKIISIDLQEEEIAG
3cjtC           -------------------------------PGDKVLDLGTGSGVLAIAAEK-LGGKALGVDIDPMVLPQ
3d2lA           -------------------------------PGKRIADIGCGTGTATLLLADHYEVTGVDLSEEL-----
3a27A           IHKEYGCLFKLKIMWSQGNIEERKRMAFISNENEVVVDMFAGIGYFTIPLAKYSKPKLVYAIEKNPTAYH
1e50E           ----------------------------------------------------------------------
3dmfA           -------------------------------RGRQVLDLGAGYGALTLPLAR-MGAEVVGVEDDLASVLS


                         .         .         .         +         .         .         .:280
query           SRDRAAKRGLAGNVRFELQDYRYLPASKKYDRIVSVGMFEHVGPTHYRDYFDKVAEVLDDKGVMVLHSIG
2eg5A           CYCLQWLSQVPSTELIGTNKGSIYSS--KASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCIC
3dp7A           MRKQTAGLSGSERIHGHGANLLDVPFPTGFDAVWMSQFLDCFSEEEVISILTRVAQSIGKDSKVYIMETL
2aowA           SAEQIAKYKELVAKISNLENVKFAWHKETSKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVS
3busA           ANARATAAGLANRVTFSYADADLPFEDASFDAVWALESLHHP----DRGRALREARVLRPGGTVAIADFV
1dl5A           AKRNVERLGIENVIFVCGDGYYGVPEFSPYDVIFVTVGVDE--------VPETWFTQLKEGGRVIVPINL
3e7pA           FNKNAEKLNLQNRVKGIVGSMDDLS--FEKDSLDLIWSEGAIYNIGFERGLKEWRNYLKPGGYLAVSESV
3bwbA           KQHFPQISRSLADPRATVRVGDGRQTPDNTYDVVIIDTTDPASKLFGEAFYKDVLRILKPDGICCNQGES
2eg5E           CLQWLSQVPSGLTELIGTNKGSIYSS--KASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCIC
3bgvA           CQQRYEDMKNRFSAEFITADSSKEDPQMCFDICSCQFVCHYESYEQADMMLRNACERLSPGGYFIGTTPN
1dl5B           AKRNVERLGIENVIFVCGDGYYGVPEFSPYDVIFVTVGVDE--------VPETWFTQLKEGGRVIVPINL
3busB           ANARATAAGLANRVTFSYADADLPFEDASFDAVWALESLHH----PDRGRALREARVLRPGGTVAIADFV
2as0A           AKENAKLNGVEDRKFIVGSAFEEEKKGEKFDIVVLDPPAFVQHEKDYFNVNFAGLNLVKDGGILVTCSC-
2an4A           LGRWLQEEPGAFNWSMYSQHACLIPAPLPADALVSAFCLEAVSPDSFQRALDHITTLLRPGGHLLLIGAL
1d2gA           ALKERWNRRKEPAFDKWVIEEANWAGDGFDAVICLGNSFAHLPDSKHRLALKNIASMVRPGGLLVIDHKN
3bgvB           CQQRYEDMKNRRDSEFITADSSKELLIMCFDICSCQFVCHYSSYEQADMMLRNACERLSPGGYFIGTTPN
2an3B           LGRWLQEEPGAFNWSMYSQHACLIPAPLPADALVSAFCLEAVSPASFQRALDHITTLLRPGGHLLLIGAL
2aotB           NLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYV--KDIPATLKFFHSLLGTNAKMLIIVVS
3b5iB           VPESVTDRR------SAAYNRGRVFIHGAGEKTTTAYKRQFQ--ADLAEFLRARAAEVKRGGAMFLVCLG
2an3A           LGRWLQEEPGAFNWSMYSQHACLIPAPLPADALVSAFCLEAVDLASFQRALDHITTLLRPGGHLLLIGAL
3dlcA           LKNIADANLNDRIQIVQGDVHNIPIEDNYADLIVSRGSVFFW--EDVATAFREIYRILKSGGKTYIGGGF
2aztB           ALKERWNRRHEPAFDKWVILDKDVPQEGGFDAVICLGNSFAHDQSEHRLALKNIASMVRAGGLLVIDNRN
2dulA           MKRNVMLNFDGELRESKGRAILKGEKTIVINHDDANRLMALDPFGSPMEFLDTALRSAKRRGILGVTATD
2b2cA           AKKFLPGMSCG----FSHPKLDLFCGDGFEFLKNHKNEFDVI--ITDSSYYELLRDALKEDGILSSQGES
2an4B           LGRWLQEEPGAFNWSMYSQHACLIPAPLPADALVSAFCLEAVDLASFQRALDHITTLLRPGGHLLLIGAL
2bm8K           SRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDNAHANTFNIMKWAVDHLLEEGDYFIIEDMW
3bkxA           PLTLGQAWNHTVHFNTNLSDDLGPIADQHFDRVVLAHSLWYFASANALALLFKNAAVCDHVDVAEWSQPT
3c6kB           CKKYMRKVLDNLCYQVLIEDCIPVLEGREFDYVINDLTAVPISWEFLRLILDLSMKVLKQDGKYFTQGNC
3dp7B           RKQTAGLSGSERIHGHGANLLDRDVPFPTGFDVWMSQFLDCFSEEEVISILTRVAQSIGKDSKVYIMETL
3egeA           VVHPQVEWFTGYAENLALPDK-------SVDGVISILAIHHF---SHLEKSFQEQRIIRDGTIVLLTFDI
2a14A           LEKWLKKEPGAYDWTPAVKFACELE--GNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVL
1bhjA           ALKERWNRRKEPAFDKWVIEEANWAGDGFDAVICLGNSFAHLDQSEHRLALKNIASMVRPGGLLVIDHRN
1d2hA           ALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFPDSKGDQSEHRLALKNIASMVRPGGLLVIDHKN
3b3gA           AEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGD
2e5wA           MLSDKHEKGKLIIGDGVKFIEENSGFDVIIVDSTDPVGPAEM--LFSEEFYKNAYRALNDPGIYVTQAGS
2b25B           AKKNYKHWRDSWKLSHVEEWPDNVDIHKDISGATFDAVALDM--LNPHVTLPVFYPHLKHGGVCAVYVVN
1dusA           AKENIKLNNLDNYDIRVVHSDLYENVKDRKYNKIITNPPIRAGKEVLHRIIEEGKELLKDNGEIWVVIQT
3c6kA           CKKYMRKVLDNLCYQVLIEDCIPVLEGREFDYVINDLTAVPISTEFLRLILDLSMKVLKQDGKYFTQCVN
3ccfA           RQNYP--------HLHFDVADARNFRVDKPLDAVFSNALHWV--KEPEAAIASIHQALKSGGRFVAEFGG
2aotA           SAEQIAKYKELVKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVS
3c6mA           CKKYMRKNLKGDCYQVLIEDCIPVLEGREFDYVINDLTAVPISTTWLRLILDLSMKVLKQDGKYFTNCVN
3c6mB           CKKDVLDNLKGDCYQVLIEDCIPVLEGREFDYVINDLTAVPISTEFLRLILDLSMKVLKQDGKYFTQCVN
2cmgA           FISFFPHFHE-VKNNKNFTHAKQLLDIKKYDLI-------FCLQEPDIHRIDGLKRMLKEDGVFISVAKH
3bwbB           KQHFPQISRSLARATVRVGDGLAFVRQTPDNTYDVVIIDTDPAGLFGEAFYKDVLRILKPDGICCNESIW
3c6mD           CKKYMRKTCGGDCYQVLIEDCIYAKEGREFDYVINDLTAVPISTEFLRLILDLSMKVLKQDGKYFTNCVN
3b3fA           AEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGD
3bgvC           CQQRYEDMKNRRDYIFSAEFITADSPQMCFDICSCQFVCHYESYEQADMMLRNACERLSPGGYFIGTTPN
2bh2A           GQQNARLNGLQNVTFYHENLEEDVTK-QPWAKNGFDKVLLDPARAGAAGVMQQIIKLEPIRIVYVSATLA
3e8sA           ARAAGAGE---VHLASYAQLAEAKV---PVGKDYDLICANFALLHQDIIELLSARTLLVPGGALVIQTLH
2ejuA           MKRNVMLNFD-GELRESKGRAILKGEKTIAERHRYFHFIDLDPFGSPMEFLDTALRSAKRRGILGVTATD
3e05B           ---FIRDNLKKFVARNVTLVEAFAPGLDDLPDPDRVFIGGSG--GMLEEIIDAVDRRLKSEGVIVLNAVT
2e58D           FPILPEPYREIHEFLLERVPEYEGERLSLKVLLGDARKRIKEPELWTLDFLSLIKERIDEKGYWVSYSSS
3dliA           CEGKFNVV------KSDAIEYLKSLPDKYLDGVMISHFVEHLDPERLFELLSLCYSKMKYSSYIVIESPN
2e58B           FPILPEPYREIHEFLLERVPEYEGERLSLKVLLGDARKRIKEPELWTLDFLSLIKERIDEKGYWVSYSSS
2b9eA           MATLLARAGVSCCELAEEDFLAVSPSDPRLDPSCSGVRLHAL--AGFQQRALCHALTFPSLQRLVYSTC-
3bkwA           --ARARAAGPDTGITYERADLDKLHPQDSFDLAYSSLALHYV--EDVARLFRTVHQALSPGGHFVFSTEH
2bm9B           SRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDNAHANTFNIMKWAVDHLLEEGDYFIIEDMW
3c3yA           GLPFIRKAGVEHKINFIESDAMDNLLQGQESEGSYDFGFVDADKPNYIKYHERLMKLVKVGGIVAYDNTL
2br5D           SRCQIPASDMENITLHQGDCTFEHLREMAHPLIFIDNAHANT----FNIMKWAVDHLLEEGDYFIIEDMI
3e05G           FIRDNLKKFVARNVTLVEAFAPEGLDD--LPDPDRVFIGGSG--GMLEEIIDAVDRRLKSEGVIVLNAVT
3egiB           ARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWAETFDIRTSPDGFEIFRLSKKITNNIVYFLP
2bh2B           GQQNARLNGL-QNVTFYHENLEEDVTKQPWAKNGFDKVLLDPARAGAAGVMQQIIKLEPIRIVYVSCNPA
2aouB           SAEQIAKYKELVAKTSNLENVKFAWELQKWDFIHMIQMLYYV--KDIPATLKFFHSLLGTNAKMLIIVVS
3ccfB           NAATIEKARQNYPHLHFDVADARNFRVDKPLDAVFSNALHWV--KEPEAAIASIHQALKSGGRFVAEFGG
1dctA           YESNHSAKLIKGDISKISSDEFPKCDGIIGGPPCQSWSEGGSLRGIDDPRG---------KLFYEYIRIL
3c3pA           HARRLHDNGLIDRVELQVGDPLGIA----AGQRDIDILFDCDV--FNGADVLERNRCLAKNALLIAVNAL
3bzbA           LESNIREPKVVPYRWGDSPDSLQRCTGLRFQVVLLADLLSFH--QAHDALLRSVKLLALPANDPTAVALV
3cjtA           AEANAKRNGVRPRFLEGSLEAALPF--GPFDLLVANLYAE-----LHAALAPRYREALVPGGRALLTGIL
3a25A           LVENIHLNKVEDRMSAYNMDNRDFPGENIADRILM------GYVVRTHEFIPKALSIAKDGAIIHYHNTV
3bzbB           SLESNIREHRASPKVVPYRWGDRCTGLQRFQVVLLADLLSFH--QAHDALLRSVKLLALPANDPTAVALV
3cggB           AKQDFPEAR-----WVVGDLSVDQISETDFDLIVSAGNVGFLAEDGREPALANIHRALGADGRAVIGFGA
2br5E           SRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDNAHANTFNIMKWAVDHLLEEGDYFIIEDMI
3bgdA           FFAEQNLSYTEPLAEIAGAKVFPRANIGKFDRIWDRGALVAINPGDHDRYADIILSLLRKEFQYLVAVLS
3eeyB           TTKKLTDLNLIDRVTLIKDGHQNMDIDCPVKAVMFNLGYLPSGDHSISTRPETT----------------
2e5wB           MLSDKHEKGKLIIGDGVKFIEEN----SGFDVIIVDSML------FSEEFYKNAYRALNDPGIYVTQAGS
2bm8B           SRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDNAHANTFNIMKWAVDHLLEEGDYFIIEDMW
2admA           PPWAEGILAD-FLLWEPGEAFDLILGNPPYGIVGVFKAVKDLYKNLYGAFLEKAVRLLKPGGVLVFVVPA
1cmvB           VTQRFPDLTAADRDGLRAQWQRGDPFRSDSYGLLGNSVDAL--------YIRERLPKLRYDKQLVGVTER
3bxoA           ARKRLPDATLHQGDMRDFRLGRKFSAV--VSMFSSVGYLKTT--EELGAAVASFAEHLEPGGVVVVEPWW
3c3pC           ARRLHDNGLIDRVELQVGDPLGIAAGQRDIDILFDCDV-------FNGADVLERNRCLAKNALLIAVNAL
3a17D           DIDGNFLDLSYNIGHWASLDQLERWSESHPTHLRIFTTFFRVAAGLSKLRLYHEVSVFDAADQLYEYINC
3eeyI           TTKKLTDLNLIDRVTLIKDGHQDKYIDCPVKAVMFNLGYLPSGDHSISTRPETT----------------
2br4F           SRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDDAHANTFNIMKWAVDHLLEEGDYFIIEDMI
2e58A           FPILPEPYREIHEFLLERVPEYEGERLSLKAVFHDAFSPYKNPELWTLDFLSLIKERIDEKGYWVSYSGF
3bt7A           AQYNIAANHIDNVQIIRMAAEEFTQAMNGVREFNRLQGIDLKSYQCRSGLDSETEKMVQAYPRILYISCN
2bm8G           SRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDNAHANTFNIMKWAVDHLLEEGDYFIIEDMW
3c6mC           CKKYMRKTCGDVLDNCIPVLKRYAKEGREFDYVINDLTAVPITWEFLRLILDLSMKVLKQDGKYFTNCVN
3bwcB           KQHFPQISRSLARATVRVGDGLAFVRQTPDNTYDVVII-------DTEAFYKDVLRILKPDGICCNQGES
3c3pB           ARRLHDNGLIDRVELQVGDPLG-----IAAGQRDIDILFDCDV--FNGADVLERNRCLAKNALLIAVNAL
1aqjA           PPWAEGILADF-LLWEPGEAFDLILGNPPYGIVAVKDLYKKAKYNLYGAFLEKAVRLLKPGGVLVFVVPA
2bm8A           SRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDNAHANTFNIMKWAVDHLLEEGDYFIIEDMI
1e50Q           -----------------------LVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAG
3eeyA           TTKKLTDLNLIDRVTLIKDGHQNMDKDCPVKAVMFNLGYLPSGDHSISTRPETT----------------
3e05E           FIRDNLKKFVARNVTLVEAFAPEGLD--DLPDPDRVFIGGS--GGMLEEIIDAVDRRLKSEGVIVLNAVT
1admA           PPWAEGILADFLLWEPGEAFDLILG---NPPYGIVGEAPIH--VFKAVKDLYKKAFSTWKGKYNLYGAFL
3b5iA           LFQLLPPLNRSYFVAGVPGSFYRRLPARTIDFFHSAFSLHWLSQADLAEFLRARAAEVKRGGAMFLVCLG
3e05A           GFIRDNLKKF-VARNVTLVEAFAPEGLDDLPDPDRVFIGGSGG--MLEEIIDAVDRRLKSEGVIVLNAVT
3e05D           -GFIRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSG--GMLEEIIDAVDRRLKSEGVIVLNAVT
2br3D           SRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDDAHANTFNIMKWAVDHLLEEGDYFIIEDMI
3cvoA           AWLAANPPAEGTEVNIVWTDIGPTGDWGHPEGFRHPDVVLVDGRFRVGCALATAFSITRPVTLLFDDYSW
3c0kA           ARQNVELNKLDLSKDVFKLLRTYRDRGEKFDVIVDPPKFVENKACRGYKDINLAIQLLNEGGILLTFSCS
3cjqD           AEANAKRNGVRPRFLEGSLEAALPFGP--FDLLVANLYAE-----LHAALAPRYREALVPGGRALLTGIL
3bwmA           TQRMVDFAGVKDKVTLVVGASQDIIPQLKKKTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVI
2ckdA           STTLAEHGVTPTADRREVPIRSAGFDPSARTAWLAEGLLMYLPATAQDGLFTEIGGLSAVGSRIAVETSP
3a17B           DIDGNFLDLSYNIGHWASLDQLERWSESHPTHLRIFTTFFRVAAGLSKLRLYHEVSVFDAADQLYEYINC
3bgvD           CQQRYEDMKNRRDSYIFSAEFIFRDPQMCFDICSCQFVCHYSSYEQADMMLRNACERLSPGGYFIGTTPN
1aqiA           PPWAEGILADFLLWEPGEAFDNPPYGIVKAVKDLYKKAFSTWKGKYYGAFLEKAVRLLKPGGVLVFVVPA
2br3B           SRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDDAHANTFNIMKWAVDHLLEEGDYFIIEDMI
3e05H           IRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSG-----GMLEEIIDAVDRRLKSEGVIVLNAVT
3egiD           ARNNAEVYGIADKIEFICGDFLLLA--SFLKADVVFLSPPWGAETFDIRTSPDGFEIFRLSKKIT-NNIV
3egiA           ARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWATAET-FDIRTSPDGFEIFRLSKKITNNIV-
3e05C           FIRDNLKKFVARNVTLVEAFAPEGL----DDLPDPDRVFIGGSGGMLEEIIDAVDRRLKSEGVIVLNAVT
3duwA           ARSNIERANNDRVEVRTGLALDSLQQIENEKYEPFDFIFIDADKQNNPAYFEWALKLSRPGTVIIGDNVV
2b25A           AKKNYKHWRDSWKLSHVEEWPDNVFIHKDISGATFDAVALDML--NPHVTLPVFYPHLKHGGVCAVDGIR
1cmoA           -------------------DHPGELRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAG
2aztA           ALKERWNRRHEPAFDKWVIEEANWM--TLDKDVPQEGGFDAVICLEHRLALKNIASMVRAGGLLVIDNRN
3cggA           AKQDFPEARWVVGDLSVDQISET-----DFDLIVSAGNVGFLAEDGREPALANIHRALGADGRAVIGFGA
3cc8A           AKEKLDHV-------VLGDIETDPYEEEQFDCVIFGDVLEHL--FDPWAVIEKVKPYIKQNGVILASIPN
2cwwB           VRVLEANAFDLLRRLEKEGERFDLVLDPPAFAKGKKDVERA--YRAYKEVNLRAIKLLKEGGILATASCS
3cjqA           AEANAKRNGVR--PRFLEGSLEAALPFGPFDLLVANLYAE-----LHAALAPRYREALVPGGRALLTGIL
3d2lC           EKAETNRHVDFWVQDRELELPEPVDAI--TILCDSLNYLQTE--ADVKQTFDSAARLLTDGGKLLFDVHS
3dh0A           NYAWEKVNKLGLKNVEVLKSEENKIPLPDNTVDFIFMAFTFHELSEPLKFLEELKRVAKPFAYLAIIDW-
3a15B           DIDGNFLDLSYNIGHWASLDQLERWSESHPTHLRIFTTFFRVAAGLSKLRLYHEVSVFDAADQLYEYINC
1e50A           -----------------------LVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAG
3bkwB           -ARARAAGPDTGITYERADLDKLHLPQDSFDLAYSSLALHYV--EDVARLFRTVHQALSPGGHFVFSTEH
3e05F           IRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSGG-----MLEEIIDAVDRRLKSEGVIVLNAVT
2br3A           SRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDDAHANTFNIMKWAVDHLLEEGDYFIIEDMI
2br4A           SRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDDAHANTFNIMKWAVDHLLEEGDYFIIEDMI
2b3tA           AQRNAQHLA-IKNIHILQSDWFSALAGQQFAMIVSNPPYIDEQ--DPHLQQGDVRFEPLTALVAADSGMA
2dpmA           ELISAISVYINNNQLEIKVGEKAIVDVRTGDFVYFDPPYIPLFTSYQVRLRDAFKRLSDTGAYVMLSNSS
3e23A           ASRRLGRP------VRTLFHQLDAIDAYDAVWAHACLLHVPR--DELADVLKLIWRALKPGGLFYASYKS
3bwcA           KQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDT--TFGEAFYKDVLRILKPDGICCNQGES
1aqjB           PPWAEGILADFLLWEPGEAFDLILGNPPYGIVFKAVKSTWKGKYNLYGAFLEKAVRLLKPGGVLVFVVPA
3c6kD           CKKYMRKDVLDNCYQVLIEDCIYAKEGREFDYVINDLTAVPISTSPLRLILDLSMKVLKQDGKYFTQG-N
1eanA           -----------------------LVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAG
2cwwA           AEENARLNGLGLRRLEKEGERFDLVLDPPAFAKGKKDVERAY--RAYKEVNLRAIKLLKEGGILATASCS
3cjqG           AEANAKRNGV--RPRFLEGSLEAALPFGPFDLLVANLYAE-----LHAALAPRYREALVPGGRALLTGIL
2br3F           SRCQIPASDMENITLHQGDCSDLTTFEHLREMAHPLIFIDDAHANTFNIMKWAVDHLLEEGDYFIIEDMI
3ckkA           VQDRIRALRAAPAGIACLRSNAMKHLPNFFYKGQLTKMFFLFPDIISPTLLAEYAYVLRVGGLVYTITDV
3dulA           ARSNIERANLNDRVEVRTGLALDSLQIENEKYEPFDFIFIDADKQNNPAYFEWALKLSRPGTVIIGDNVV
3dh0B           NYAWEKVNKLGLKNVEVLKSEENKIPLPDNTVDFIFMAFTFHELSEPLKFLEELKRVAKPFAYLAIIDW-
3eeyC           TTKKLTDLNLIDRVTLIKDGHQNMYIDCPVKAVMFNLGYLPSGDHSISTRPETT----------------
1eg2A           YQKQLTFLRSYEIVEGAANFGAALQ---------------------------------------------
2ar0B           ALNCLLHDIEGNLDHGGAIRLGNTLGLPKAHIVATNPPFGSAAGTNKQLCFQHIIETLHPGGRAAVVVPD
1co1A           -----------------------LVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAG
2br5F           SRCQIPASD-MENITLHQGDCHLREMA--HPLIFIDNAHANT----FNIMKWAVDHLLEEGDYFIIEDMI
1eizA           GVDFLQGDFRALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLAPGGSFVVKVFQ
2d16A           AAKNAVKIGAGHVFVILMKNAYNHPAVAMIYGASENPFQVIVAETEKAANKIETDEQKKERRELVE----
3cjtG           AEANAKRNGVRPRFLEGSLEAAL--PFGPFDLLVANLYAE-----LHAALAPRYREALVPGGRALLTGIL
3bwyA           TQRMVDFAGMKDKVTLSQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVI
1booA           SAFRFLDNNIS---EEKITDIYNRINGESLDLNS------------------------------------
3eeyF           TTKKLTDLNLIDRVTLIKDGHQDKYIDCPVKAVMFNLGYLPSGDHSPETTIQALSKAM------------
3dtnB           AKNRFRGN---LKVKYIEADYSKYDFEEKYDMVVSALSIHHLEDEDKKELYKRSYSILKESGIFINADLE
2avnA           REKGVKNVVEAKAEDLPFPSGAFEAV------LALGDVLSYV--ENKDKAFSEIRRVLVPDGLLIATVDN
3dxzA           CLASAHEEGLSNLRVMCHDAVEVLIPDNSLRMVQLFFPDPWHKARHQVPFAELVKSKLQLGGVFHMATDW
2ekmA           AQQTALKIGAGHTFVIYIKN--------GFPINVLNRIK---NVEEVVRIFAATANPLQVLVAEGRGVIG
2br5C           PASDMENITLHQGDCSDLTTFEHLR-----EMAHPLIFIDNAHANTFNIMKWAVDHLLEEGDYFIIEDMI
3dulB           ARSNIERANLNDRVEVRTGLALSLQQIENEKYEPFDFIFIDADKQNNPAYFEWALKLSRPGTVIIGDNVV
3eeyG           TTKKLTDLNLIDRVTLIKDGHQNMDIDCPVKAVMFNLGT------RPETTIQALSKAM------------
2br5A           PASDMENITLHQGDCSDLTTFEHLR-----EMAHPLIFIDNAHANTFNIMKWAVDHLLEEGDYFIIEDMI
3cbgA           AKKYWQKAGVAEKISLRLGPALATLLTQGKPLPEFDLIFIDADKRNYPRYYEIGLNLLRRGGLMVIDNV-
3dr5A           AKALFREAGYSPSRVRFLLSRPLDVSNDSYQLVFGQVSPDLK------ALVDAAWPLLRRGGALVL----
3dtnA           EIAK-NRFRGNLKVKYIEADYSKYDFEEKYDMVVSALSIHHLEDEDKKELYKRSYSILKESGIFINADLV
2cl5B           TQQMLNFAGLQDKVTILNGASQDLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVI
2cl5A           TQQMLNFAGLQDKVTILNGASQDLIPQLKKKYLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVI
2bt8A           GRRTDYMMSSTGNLTVTSNVVLLTLSDITSDLARLVPSAGFQAASFPVDV------SFTRDSATHAYQAY
1af7A           ARSGIVRQELANYVEFSSVNLLEKQVPGPFDAIFCRNVMIYFDKTTQEDILRRFVPLLKPDGLLFAGHSE
3c6kC           CKKYMRKLDNGDCYQVLIEDCRYAKEGREFDYVINDLTAVPISTEFLRLILDLSMKVLKQDGKYFTQG-N
2eg5G           ----------------------------------------------------------------------
3cjrA           AEANAKRNGVRPRFLEGSLEAALPFGPFDL-------LVANLYAELHAALAPRYREALVPGGRALLTGIL
2bzgA           FFTEQNLSYSEEPITEIPCSIFDLPRTNIGKFDIWDRGALVAINPGDRKCYADTFSLLGKKFQYLLCVLS
3dxyA           CLASAHEEGLSNLRVMCHDAVEVLHPDNSLRMVQLFKARHNKRRIVQVPFAELVKSKLQLGGVFHMATDW
2d16B           AAKNAVKIGAGHVFVILMKNAYNHPAVAMIYGASENPFQVIVVVDGKAANKIETDEQKKERRELVE----
3dxxA           CLASAHEEGLSNLRVMCHDAVEVLHPDNSLRMVQLFKARHNKRRIVQVPFAELVKSKLQLGGVFHMATDW
1e50C           -----------------LADHPGELRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAG
1eaoA           -------------MVEVLADHPGELRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAG
2avdA           GRPLWRQAEAEHKIDLRLALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVL
2ckdB           STTLAEHGVTPTADRREVPIDLRQDWPPALRAWLAEGLLMYLPATAQDGLFTEIGGLSAVGSRIAVETSP
1bc5A           ARSGRVRQELANYVEFSSVNLKQYNVPGPFDAIFCRNVMIYFDKTTQEDILRRFVPLLKPDGLLFAGHSE
3douA           VRFIRCDIFKETIFDDIDRALREEGIEKVDDKVSGIPSRDHAVSYQIGQRVEIAVRYLRNGGNVLLKQFQ
3cjtC           AEANAKRNGVRPRFLEGSLEAALPFGPFDLLVA-------NLYAELHAALAPRYREALVPGGRALLTGIL
3d2lA           EIAQEKAETNRHVDFWVQDRELELPEPVDAITILCDSLNYLQTEADVKQTFDSAARLLTDGGKLLFDVHS
3a27A           YLCENIKLNKLNNVIPILADNRDVE----LKDVADRVIMGY--VHKTHKFLDKTFEFLKDRGVIHYHETV
1e50E           -------------------DHPGELRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAG
3dmfA           LQKGLEANAL-KAQALHSDVDEALTEEARFDIIVTNPPFHVGGAVIAQAFVNVAAARLRPGGVFFLVSNP


                         .         *         .         .         .         .         +:350
query           QPYPALATNPFIEKYIFPGGYIPSLAEVLPAIQKSGLLVKDIEILPMHYAHTLRHWRERFVARKAEAVAL
2eg5A           KGVELDAEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLYDAGFSHIKAEYVASSVRAVYE
3dp7A           WDYCLTQISLYFTAMANGNSKMFHSDDLIRCIENAGLEVEEIQDNIGLGHSILQCRL-------------
2aowA           GSWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTDGNENGDLLWDFLTETCNFNATA
3busA           LLEGAKKEAVDAFRAGGGVLSLGGIDEYESDVRQAELVVTSTVDISAQARPSLVKTAEAFENARSQVEPF
1dl5A           KLSRRQPAFLLVGNYKLETRFITAFNREILLVRSHIFVELVDLIDGTFYYAGPNGVVEFLDDRMR--IYG
3e7pA           WFTDQ-RPAEIHDFWMSAYTEIDTVPNKVAQIQKAGYIPVATFCWIEHYFAPQAKAEEIFRRRIVEELIT
3bwbA           IWLDLELIEKSRFIRETGFASVQYALH---------------VPTYPCGSIGTLVCSKKAGVDVTKPLRP
2eg5E           KGVELDARNAEKLDSFNLPVYIPSAEEVKCIVEEEGSFELYLETFKVLYDFSIDHIKAEYVASSVRAVYI
3bgvA           SFELIRRLEASETESFGNPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQLPLG
1dl5B           KLLFKKKDPYLVGNYKLETRFITAFNREILLVRSHIFTRRLTEIDGTFYYAGPNGVVEFLDDRMRIY--G
3busB           PVEGAKKEAVDAFRAGGGVLSLGGIDEYESDVRQAELVVTSTVDISAQARPSLVKTAEAFENARSQVEPF
2as0A           ----------------------------------------------------------------------
2an4A           EE------SWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGWAQK------
1d2gA           YDYILSTGCAPPGKNIYYKSD-----LTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLS
3bgvB           SFELIRRLEASETESFDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLRMQRLPLGT
2an3B           EESWYLAGEARLTVVPVSEEEVREALV------RSGYKVRDLRTYIMPAHLQTGVDDVKGWAQK------
2aotB           SGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNEFLTETNFNATA
3b5iB           RTVREGLVAAEKRDGFNIPVYAPSLQDFKEVVDANGS--FAIDKLVVYKGGSPLVVNERAFASSCRSVEL
2an3A           EE------SWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGWAQK------
3dlcA           GNSAEIRKNPDWKEFNRKNISQENVERFQNVLDEIGISSYEIILGDEGFWIIISKTDQEVI---------
2aztB           YDHILSTGCAPPGKNIYTKDVTTSVLIVNNKAHMVTLDYTVQGLSKFRLSYYPHCLASFTELLQAA---F
2dulA           GAPLCRACLRKYLAVPLRGEEVGTRILVGVIARYAAKYDLGIDVILAHYFRAFVKLKDGARK--------
2b2cA           VWLHLPLIAHLVAFNRK-------------IFPAVTYAQSIVSTYPSGSMGYLICAKNANRDVTTPARTL
2an4B           EESWYLAGEARLTVVPVSEEEVREALV------RSGYKVRDLRTYIMPAHLQTGVDDVKGWAQK------
2bm8K           YRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDRGVL---------------------------------
3bkxA           ALDQQGLLYAIAPSDVANIRTLITPDTLAQIAHDNTWTYTAGTIVEDPTL-DDAHWEIATTNALLTELKL
3c6kB           LTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYT-------------------------------
3dp7B           WDYCLTQISLYFTAMANGNSKMFHSDDLIRCIENAGLEVEEIQDNIGLGHSILQCRL-------------
3egeA           RLAQRIWLYDYFPFLWEDALRFLPLDEQINLLQENTKRRVEAIPFLLPHDLSDLFAARAGISSFALANQD
2a14A           TLTVTLRLPSYMVGKREFSCVALEKGEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCVARK------
1bhjA           YDYILSTGCAPPGKNIYYKSDLTKDIT-----TSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLS
1d2hA           YDYILS------TGCAPPGKNIYYKSDLTKITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLS
3b3gA           VHLAPFTDEQLYMEQFQPSFHGVDLSALRGAAVDEYFRQPVVDTFRILMAKSVKYTVNFLEAKEGDLHRI
2e5wA           VYTDEFLTAYRKMRKVFDKVY-YYSFPVIGYASPWAFLVGVKGSIDFMKVDAEKGKKLGL----------
2b25B           ITELALSCEKISEVIVRDWLVCLVARPVHWQPGHTAFLVKLRKV--------------------------
1dusA           KQGAKKDVFGNVETVTIKGGYRV-----------------------------------------------
3c6kA           LTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKK---------------------------
3ccfA           KGYNALETLGIHNPQALNPWYFPSIGEYVNILEKQGFDVTYAALFNRPTTLAEGEFGANWIQFASAFLGL
2aotA           GSSGWDKLWKKYGSRFDDLCQYITSDDLTQMLDNLGLKYEYDLLSTMDISDCFIDGNENGDLLWDFLTTA
3c6mA           LTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVF---------------------------------
3c6mB           LTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYT-------------------------------
2cmgA           PLLEHVSMQNALKNMGGVFSVAMPFVAPLRILSNKGYIYASFKTHPIEALTSVRYYNEAFALPKNLQEVF
3bwbB           LDLELIEKSRFIRETGFASVQYALHVPTYPCGSIGTLV-----------------CSKKAGVDVTKPLRP
3c6mD           LTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVF---------------------------------
3b3fA           VHLAPFTDEQKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFRILMAKSVKYTVNFLEAKEGDLHRI
3bgvC           SFELIGCKYDFNLEGVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQRLPL
2bh2A           RDSEALLKAGYTIARLAMLDMFPHTGHL------------------------------------------
3e8sA           ADGDYQDGWREESFAGFAGDWQPRTLASWLNALDAGLRLVSLQEPQHPQSAVPQSL---LVAER------
2ejuA           GAPLCRACLRKYLAVPLRGEEVGTRILVGVIARYAAKYDLGIDVILA---YYKDHYFRAFVKLKDGARKG
3e05B           LDTLTKAVEFLEDHGYMVEVACVNVAKTKGLTEYKMFESHNPV---------------------------
2e58D           LSVKSLLTFKVGSSREIGRKRKGTVASLKAPVPPEENEVRKLVLSPFAVPRDEKLDKEPLEILIDYLLKV
3dliA           PTSLYSLINFYID---PTHKKPVHPETLKFILEYLGF--RDVKIEFFEECEELTKLAKIDSNTVSEEVIR
2e58B           LSVKSLLTFKVGSSREIGRKRKGTVASLKAPVPPEENEVRKLVLSPFAVPRDEKLDKEPLEILIDYLLKV
2b9eA           -SLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAV-------
3bkwA           PIYAPARPGWAIDAEGRRTWPIDRY------LVEGPRKTDWLAKGVVKHHRTVGTTLNALIRSGFAIEHV
2bm9B           YRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDRGVL---------------------------------
3c3yA           WGGPESEVPDFMKENREAVIELNKLLAADPRIEIVHLPLGDITFCRRLY---------------------
2br5D           PY--------------------------------------------------------------------
3e05G           LDTLTKAVEFLEDHGYMVEVACVNVAKTKGLTEYKMFESHNPV---------------------------
3egiB           RN----ADIDQVASLAGPGGQVEIE---------------------------------------------
2bh2B           TLARALLKAGYTIARLAMLDMFPHTGHL------------------------------------------
2aouB           GSWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTDGNENGDLLWDFLTETCNFNATA
3ccfB           KGYNALETLGIHNPQALNPWYFPSIGEYVNILEKQGFDVTYAALFNRPTTLAEGEFGANWIQFASAFLVG
1dctA           KQKKPIFFLAENVKGMMAQRHNKAVQEFIQEFDNAGYDVHIILLNANDYGVAQDRKRVFYIGFRKELNIN
3c3pA           RRNHHLSRRRDFFTTIVPVGNGVLLGY-------------------------------------------
3bzbA           TF----THDLAFFRLVNADGALIAEPWLSPLVHRWRLRWR------------------------------
3cjtA           KD-----RAPLVREAMAGAGF-------------------------------------------------
3a25A           EKLMPREPFETFKRITKEYGYDVEKLNE------------------------------------------
3bzbB           HRPHLAERDLAFFRLVNADGALIAEPWLSPLQQVHRW---------------------------------
3cggB           GRGWVGDFLEVAERVGLELENAFESWDLKPFVQGSEFLVAVFT---------------------------
2br5E           PYWYRYLFSEYLGAFRDVLSMDMLYANASSQLDRGVL---------------------------------
3bgdA           YDPTKHAGPPFLFGTKCSMQCLEEVDALEERHKAWGLDYLFEKLY-------------------------
3eeyB           ----------------------------------------------------------------------
2e5wB           VYLFTDEFLTAYRKMRKVFKVYYYSFPVIGYASPWAFLVGVKGSIDFMKVDAEKGKKLGL----------
2bm8B           YRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDRGVL---------------------------------
2admA           ALLREFLAREGKTSVYYLGEVFPQKKVSAVRFQKSGKGLSLWDTQESESGFTPILWAEYPHWEGEIIRFE
1cmvB           ESY-------------------------------------------------------------------
3bxoA           FADGWVSADVVRRDGRTVARVSHSVREGNATRMEVHFTVADPGKGVRHFSDVHLITLFHQ----AEYEAA
3c3pC           RRGHHLSRRRDFFTTIVPVG--------------------------------------------------
3a17D           HPGTGML---------------------------------------------------------------
3eeyI           ----------------------------------------------------------------------
2br4F           PYWYR-----------------------------------------------------------------
2e58A           KVGSSREIRKGTVASLKAPVPPEENEVRKLVLSPFAVPRDEKLDKEPLEILIDYLLK-------------
3bt7A           PETLCTLSQTHKVERLALFDQFP-----------------------------------------------
2bm8G           YRYAPQLFSEYLGAFRDVLSMDMLYANASSQLDRGVL---------------------------------
3c6mC           LTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP------------------------
3bwcB           IWLDL-ELIEKSRFIRETGFASVQYALHVPTYPCG------------SIGTLV--CSKKAGVDVTKPLRP
3c3pB           RRNHHLSRRRDFFTTIVPVGNGVLLG--------------------------------------------
1aqjA           TWLVLEDFALFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQESESGFTPILWAEYPHWE
2bm8A           PYWYRYLFSEYLGAFRDVLSMDMLYANASSQLDRGVL---------------------------------
1e50Q           NDEYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKIT----------
3eeyA           ----------------------------------------------------------------------
3e05E           LDTLTKAVEFLEDHGYMVEVACVNVAKTKGLTEYKMFESHN-----------------------------
1admA           EKVRLLKPGGVLVFVVPATWLVLEDFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLW
3b5iA           RTHFQDAWDDLVREGLVAAEKRPSLQDFKEVVDANGSAIDKLVVYKGGSPLVVNEPDDASEVGRAFASEL
3e05A           LDTLTKAVEFLEDMVEVACVNVAKTKEYKMFESHNPVYIITAW---------------------------
3e05D           LDTLTKAVEFLEDHGYMVEVACVNVAKTKGLTEYKMFESHN-----------------------------
2br3D           PYWYR-----------------------------------------------------------------
3cvoA           QHQVEEFLGAPLIGRLAAFQVEPQPPGSL-----------------------------------------
3c0kA           GLTS------------------------------------------------------------------
3cjqD           KD-----RAPLVREAMAGAGF-------------------------------------------------
3bwmA           CPGAPDFLAHVRGSSCFHYQSFLEYREVVDGLEKAIY---------------------------------
2ckdA           LHVSDALGFEQAVDVQELIYHDENRAVVADWLNRHGW--RATAQSAPDEMRRVGRWGDGVPMADDKDAFA
3a17B           HPGTGML---------------------------------------------------------------
3bgvD           SFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEVDVPEFLVYFPLLNEMA--KKYNMKLV
1aqiA           TWLVLEDFALFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQESESGFTPILWAEYPHWE
2br3B           PYWYR-----------------------------------------------------------------
3e05H           TKAVEFLEDHGYMVEVACVNVAKTKGEYKMFESHNPVYIITAW---------------------------
3egiD           YFLPRNADIDQVASLAGPGGQVEI----------------------------------------------
3egiA           YFLPRNADIDQVASLAGPGGQVEI----------------------------------------------
3e05C           ---------------------LDTLTKAVEFLEDHGYMVEVACNVAKTKGTEYKMFESH-----------
3duwA           RE--------------------------------------------------------------------
2b25A           TCELALSCEKISEVIVRDWLVCLVARPVHWQPGHTAFLVKLRKV--------------------------
1cmoA           NDEYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREP---
2aztA           YDHILSTGCAPPGKNIYYKSDLT--KDVTTSV---LIVNNKAHMVTLDYTVGLSKFRLSYYPHCLASFEL
3cggA           GRGVFGDFLEVAERVGLELENAFESWDLKPFVQGSEFLVAVFT---------------------------
3cc8A           VSHISVLAPLLAGNWTYTHIRFFTFNELRFLKAGYSISKVDRVYVDHKYEPLIEELYGICKKYRLGSG--
2cwwB           HHMTEPLFYAMVAEAAQDAHRLLRVVE----------KRGQPFDHPVLLNHPETHYLKFAVFQV------
3cjqA           KD-----RAPLVREAMAGAGF-------------------------------------------------
3d2lC           PYKETLFNGKTYATHAEYIWFADPGEEPLSVVHELTFFIEGEDGRYDRVDETHHQRTYPP-EQYITWLRE
3dh0A           --------KKEERDKGPPPEEVYSEWEVGLILEDAGIRVGRVVEVGKYCFGVYA----------------
3a15B           HPGTGML---------------------------------------------------------------
1e50A           NDNYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDG-------
3bkwB           PIWAIGRRTWPIDRYLVEGPHHRTVGTTLNALIRSGFAIEHVEEFCPTDAQITARPELAEELDRPFLL--
3e05F           ---------------------LDTLTKAVEFLEDHGYMVEVACVNVATKGKMFESHNPVYIIT-------
2br3A           PYWYRYA-PQLFSEYL------------------------------------------------------
2br4A           PYWYRYA-PQLFSEYL------------------------------------------------------
2b3tA           DIVHII---EQSRNALVSGGFLQQGEAVRQAFILAGYHDVETCDYGDNERVTLGRY--------------
2dpmA           SA--------------------------------------------------------------------
3e23A           GEG-------EGRDKLARYYNYPSEEWLRARYAEAGTAVESSEGKGFDQELAQFLH---VSVRKPE----
3bwcA           -IWLDLELIEKSRFIRETGFASVQYALHVPTYPCGSIGTLVCSK---KAGVDVTKPLRPVEDPFAKDLKY
1aqjB           TWLVLEDFALFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQESESGFTPIHWEGEIIRF
3c6kD           CVNLTEALSLYLGRLYCPVEFSKEIVCV------------------------------------------
1eanA           NDENYSAELRNATAAMNQVARFNDLRFVGRSGRGKSFTVFTNPPQVATYHRAIKITVD------------
2cwwA           HHMTEPLFYAMVAEAAQDAH-------------RLLRVVEKRGQPFDHPVLLNHPETKFAVFQV------
3cjqG           KD-----RAPLVREAMAGAGF-------------------------------------------------
2br3F           PYWYR-----------------------------------------------------------------
3ckkA           LELHDWMCTHFEEHPLFVVGHLGTSTEEGKKVLRNGGKNFPAI---------------------------
3dulA           RIRRFYELIAAEPRVSATAL--------------------------------------------------
3dh0B           --------KKEERDKGPPPEEVYSEWEVGLILEDAGIRVGRVVEVGKYCFGVYAMI--------------
3eeyC           ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
2ar0B           NVLFEGGKGTDIRRDLDKCHL------------HTILRLPTGIFYAQGVKTNVLFFTKGTVANPNQDKNC
1co1A           NDEYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNATYHRAIKITVDGP----------
2br5F           -PYWYRYAPQLFSEYLFRDVLSMDMANASSQLDRGVL---------------------------------
1eizA           GE--------------------------------------------------------------------
2d16A           ----------------------------------------------------------------------
3cjtG           KD-----RAPLVREAMAGAGF-------------------------------------------------
3bwyA           CPGAPDFLAHVRGSSCFHYQSFLEYREVVDGLEKAIY---------------------------------
1booA           ----------------------------------------------------------------------
3eeyF           ----------------------------------------------------------------------
3dtnB           TAFIENLNKTIWRQYVENSGLTE------------EEIAAGYERSKLDKDIEMNQQLNWLKEAGFRDVSC
2avnA           TFLQQIEKDAWDQITRFLKTQTTSVGTTLFSFNSYAFKPEDLDSLEGFETVDIRGIGVEYPDERISEREE
3dxzA           EPYAVMSSIDGYKNLSESNDYVPRPAS-------------------------------------------
2ekmA           VVDGYTPLGIETEADIKERKEL------------------------------------------------
2br5C           -PYWYRYAPQLFSEYL------------------------------------------------------
3dulB           REVIIRRFYELIAAEPRVSA--------------------------------------------------
3eeyG           ----------------------------------------------------------------------
2br5A           -PYWYRYAPQLFSEYL------------------------------------------------------
3cbgA           ----------------------------------------------------------------------
3dr5A           ----------------------------------------------------------------------
3dtnA           HGETAFIENLEEEIAAGYLDKDIEMNQQLNWLKEAGF--RDVSCIYKYYQFAVMFGR-------------
2cl5B           VPGTPAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIY---------------------------------
2cl5A           VPGTPAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIY---------------------------------
2bt8A           GVYSSSR----VFTITFPTGGDG-----------------------------------------------
1af7A           NFSNLVREFSLRGQTVY-----------------------------------------------------
3c6kC           CVNLTEALSLYEEQL-------------------------------------------------------
2eg5G           ---------------------------------------------KVLYDAGFSHIKAEYVASSVRAVYE
3cjrA           KD-----RAPLVREAMAGAGF-------------------------------------------------
2bzgA           YDPPFYVPHAEIERLFGKICCLEKVDAFEERHKSWGIDCLFEKLY-------------------------
3dxyA           EPYEVMSSIDGYKNLSESNDYVP-----------------------------------------------
2d16B           ----------------------------------------------------------------------
3dxxA           EPY-------------------------------------------------------------------
1e50C           NDENYSAELRNATAAMKNQVAFNDLRFVGRSGRGKSFTTNPPQVATYHRAIKITVDGPREPRR-------
1eaoA           NDENYSAELRNATAAMKNQVAFNDLRFVGRSGRGKSFTLTITVFTNATYHRAIKITVD------------
2avdA           WRGKVL----------------------------------------------------------------
2ckdB           LHVSDALGFEQAVDVQELIYHDENRAVVADWLNRHGW--RATAQSAPDEMRRVGRWGDGVPMADDKDAFA
1bc5A           NFSNLVREFSLRGQTVY-----------------------------------------------------
3douA           GDTNDF----------------------------------------------------------------
3cjtC           KD-----RAPLVREAMAGAGF-------------------------------------------------
3d2lA           PYKETLFNGKTYATHAEQSSYIWFAEEPLSVVHELTFFIEGEDGRYDRVDETHHQRTYPPYITWLREAGF
3a27A           AEKMYERPIERLKFYAEKNGYKLIDYEVRKI---------------------------------------
1e50E           NDNYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDG-------
3dmfA           FL--------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           YDERFFRMWEFYLAGSEMAFTHENFHIFQIQLAKDRDAVPHNRDYIAQNEAKLLEFEKTRPPLEKVSF
2eg5A           IFHRFAKHAAKVLPLGKGFYNN-----LIISLAK----------------------------------
3dp7A           --------------------------------------------------------------------
2aowA           PPDLRAELGKDLQEPEFSAKKEGKVLFN----------------------------------------
3busA           GAEGLDRIATFRGLAEVPEA------------------------------------------------
1dl5A           DAPEIENLLTQWESCGYRSFLHVGYNAFSHISCS----------------------------------
3e7pA           SNHHEAELYSKYKAYYGYAF------------------------------------------------
3bwbA           VEDPFAKDLKYYDSEHKASFALPRF-------------------------------------------
2eg5E           IPDIFHRFA--KHAAKVLPLGKGFYNNLIISLAK----------------------------------
3bgvA           LSKSEWEATSIYLVF-----------------------------------------------------
1dl5B           DAPEIENLLTQWESCGYRSFLHVGYNAFSH--------------------------------------
3busB           GALDRIATFRGLAEVPEAGY------------------------------------------------
2as0A           --------------------------------------------------------------------
2an4A           --------------------------------------------------------------------
1d2gA           YYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLK--------------------
3bgvB           LSKSEWEATSIYLVFA----------------------------------------------------
2an3B           --------------------------------------------------------------------
2aotB           PPDLRAELGKDLQEPEFSAKKEGKVLFN----------------------------------------
3b5iB           SNKLFSRVESRATSHAKDVLVNLQFFHIVASLSF----------------------------------
2an3A           --------------------------------------------------------------------
3dlcA           --------------------------------------------------------------------
2aztB           GGKCQHSVLGDFKPYKPGQTYIPCYFIH----------------------------------------
2dulA           GDETLEKLGYIYFDDKTGKFELEQGFLPTRPNAYVWLGPLKDEKIV----------------------
2b2cA           TAEQIKALNLRFYNSEKAAFVLPQF-------------------------------------------
2an4B           --------------------------------------------------------------------
2bm8K           --------------------------------------------------------------------
3bkxA           LRDRVKPLLEASHNGTA-SLATFTGRI-----------------------------------------
3c6kB           --------------------------------------------------------------------
3dp7B           --------------------------------------------------------------------
3egeA           LVEKGLELLTADLNNGEWIRKYGEHHLQEIDIGY----------------------------------
2a14A           --------------------------------------------------------------------
1bhjA           YYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLK--------------------
1d2hA           YYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLK--------------------
3b3gA           IPFKFHMLHSGLVHGLAFWF------------------------------------------------
2e5wA           --------------------------------------------------------------------
2b25B           --------------------------------------------------------------------
1dusA           --------------------------------------------------------------------
3c6kA           --------------------------------------------------------------------
3ccfA           TPDQQVQLIRKVEATLQDKLYHQESWTADYRR------------------------------------
2aotA           PPDLRAELGKDLQEPEFSAKKEGKVLFN----------------------------------------
3c6mA           --------------------------------------------------------------------
3c6mB           --------------------------------------------------------------------
2cmgA           KDNIK---------------------------------------------------------------
3bwbB           VEDPFAKDLKYYDSEHKASFALPRF-------------------------------------------
3c6mD           --------------------------------------------------------------------
3b3fA           IPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPL---------------------------
3bgvC           LSKSEWEATSIYLVF-----------------------------------------------------
2bh2A           --------------------------------------------------------------------
3e8sA           --------------------------------------------------------------------
2ejuA           DETLEKLGYIYFDDKTGKFELEQGFLPTRPNAYGPVWLGPKDEKIV----------------------
3e05B           --------------------------------------------------------------------
2e58D           Y-------------------------------------------------------------------
3dliA           VINENIEKLNRILFGPQ---------------------------------------------------
2e58B           Y-------------------------------------------------------------------
2b9eA           --------------------------------------------------------------------
3bkwA           ARPELAEELDRPFL------------------------------------------------------
2bm9B           --------------------------------------------------------------------
3c3yA           --------------------------------------------------------------------
2br5D           --------------------------------------------------------------------
3e05G           --------------------------------------------------------------------
3egiB           --------------------------------------------------------------------
2bh2B           --------------------------------------------------------------------
2aouB           PPDLRAELGKDLQEPEFSAKKEGKVLFN----------------------------------------
3ccfB           LTPDQQQLIRKVEATLQDKLYHQESWTADYRR------------------------------------
1dctA           YLPPIPHLIKPTFKDVIWDLKDNPIPALDKNKTNGNKCIYPNHEYFIGSYSTIFMSRNRVR-------
3c3pA           --------------------------------------------------------------------
3bzbA           --------------------------------------------------------------------
3cjtA           --------------------------------------------------------------------
3a25A           --------------------------------------------------------------------
3bzbB           --------------------------------------------------------------------
3cggB           --------------------------------------------------------------------
2br5E           --------------------------------------------------------------------
3bgdA           --------------------------------------------------------------------
3eeyB           --------------------------------------------------------------------
2e5wB           --------------------------------------------------------------------
2bm8B           --------------------------------------------------------------------
2admA           TEETRKLEISGMPLGDLFHIRFAARSPEFKKHPAVRKEPGPGLVP-----------------------
1cmvB           --------------------------------------------------------------------
3bxoA           FTAAGLRVEYLEGGPSGRGLFV----------------------------------------------
3c3pC           --------------------------------------------------------------------
3a17D           --------------------------------------------------------------------
3eeyI           --------------------------------------------------------------------
2br4F           --------------------------------------------------------------------
2e58A           --------------------------------------------------------------------
3bt7A           --------------------------------------------------------------------
2bm8G           --------------------------------------------------------------------
3c6mC           --------------------------------------------------------------------
3bwcB           VEDPFAKDLKYYDSEHKASFALPRF-------------------------------------------
3c3pB           --------------------------------------------------------------------
1aqjA           GEIIRFETEETRKLEISGMPLGDLFHIRFAARSPEFKKHPAVRKEPGPGLVPVLTGRNLKP-------
2bm8A           --------------------------------------------------------------------
1e50Q           --------------------------------------------------------------------
3eeyA           --------------------------------------------------------------------
3e05E           --------------------------------------------------------------------
1admA           DTQESESGFTPILWAEYPHWEGEIIRFET---------------------------------------
3b5iA           SNKLFSRVESRATSHAKDVLVNLQFFHIVASLSF----------------------------------
3e05A           --------------------------------------------------------------------
3e05D           --------------------------------------------------------------------
2br3D           --------------------------------------------------------------------
3cvoA           --------------------------------------------------------------------
3c0kA           --------------------------------------------------------------------
3cjqD           --------------------------------------------------------------------
3bwmA           --------------------------------------------------------------------
2ckdA           E-------------------------------------------------------------------
3a17B           --------------------------------------------------------------------
3bgvD           YKKTFLEFYEEKIKNNENKMLLKRMQRLPLGTLSK---------------------------------
1aqiA           GEIIRFETEETRKLEISGMPLGDLFHIR----------------------------------------
2br3B           --------------------------------------------------------------------
3e05H           --------------------------------------------------------------------
3egiD           --------------------------------------------------------------------
3egiA           --------------------------------------------------------------------
3e05C           --------------------------------------------------------------------
3duwA           --------------------------------------------------------------------
2b25A           --------------------------------------------------------------------
1cmoA           --------------------------------------------------------------------
2aztA           LQAAFGGKCQHSVLGKPYKPGQTYIPCYFIHVLK----------------------------------
3cggA           --------------------------------------------------------------------
3cc8A           FAETVVFQY-----------------------------------------------------------
2cwwB           --------------------------------------------------------------------
3cjqA           --------------------------------------------------------------------
3d2lC           AGFRVCAVTGDFKSDAPTETAERIFFVAE---------------------------------------
3dh0A           --------------------------------------------------------------------
3a15B           --------------------------------------------------------------------
1e50A           --------------------------------------------------------------------
3bkwB           --------------------------------------------------------------------
3e05F           --------------------------------------------------------------------
2br3A           --------------------------------------------------------------------
2br4A           --------------------------------------------------------------------
2b3tA           --------------------------------------------------------------------
2dpmA           --------------------------------------------------------------------
3e23A           --------------------------------------------------------------------
3bwcA           YDSEHFALPRFA--------------------------------------------------------
1aqjB           ETEETRKLEISGMPLGDLFHIRFAARSPEFKKHPAVRKEPGPGLVPVLTGRNLKPGWVDYEKNHSGLW
3c6kD           --------------------------------------------------------------------
1eanA           --------------------------------------------------------------------
2cwwA           --------------------------------------------------------------------
3cjqG           --------------------------------------------------------------------
2br3F           --------------------------------------------------------------------
3ckkA           --------------------------------------------------------------------
3dulA           --------------------------------------------------------------------
3dh0B           --------------------------------------------------------------------
3eeyC           --------------------------------------------------------------------
1eg2A           --------------------------------------------------------------------
2ar0B           TDDWVYDLRTNPSFGKRTPFTDEHLQPFERVYGEDPHGLSPRTEGEWSFNAEETEVADSEENK-----
1co1A           --------------------------------------------------------------------
2br5F           --------------------------------------------------------------------
1eizA           --------------------------------------------------------------------
2d16A           --------------------------------------------------------------------
3cjtG           --------------------------------------------------------------------
3bwyA           --------------------------------------------------------------------
1booA           --------------------------------------------------------------------
3eeyF           --------------------------------------------------------------------
3dtnB           IYKYYFAVMFGR--------------------------------------------------------
2avnA           TIFRLEQELSRDRNIIWKADHI----------------------------------------------
3dxzA           --------------------------------------------------------------------
2ekmA           --------------------------------------------------------------------
2br5C           --------------------------------------------------------------------
3dulB           --------------------------------------------------------------------
3eeyG           --------------------------------------------------------------------
2br5A           --------------------------------------------------------------------
3cbgA           --------------------------------------------------------------------
3dr5A           --------------------------------------------------------------------
3dtnA           --------------------------------------------------------------------
2cl5B           --------------------------------------------------------------------
2cl5A           --------------------------------------------------------------------
2bt8A           --------------------------------------------------------------------
1af7A           --------------------------------------------------------------------
3c6kC           --------------------------------------------------------------------
2eg5G           IFHRFAKHAAKVLPLGKGFYNN-----LIISLAK----------------------------------
3cjrA           --------------------------------------------------------------------
2bzgA           --------------------------------------------------------------------
3dxyA           --------------------------------------------------------------------
2d16B           --------------------------------------------------------------------
3dxxA           --------------------------------------------------------------------
1e50C           --------------------------------------------------------------------
1eaoA           --------------------------------------------------------------------
2avdA           --------------------------------------------------------------------
2ckdB           EFVTAHRL------------------------------------------------------------
1bc5A           --------------------------------------------------------------------
3douA           --------------------------------------------------------------------
3cjtC           --------------------------------------------------------------------
3d2lA           RVCAVTGDFKSD--------------------------------------------------------
3a27A           --------------------------------------------------------------------
1e50E           --------------------------------------------------------------------
3dmfA           --------------------------------------------------------------------