[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK86566.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dohB.bssp"
#ERROR : Can't open dsspfile "2b35A.bssp"
#ERROR : Can't open dsspfile "1dfiA.bssp"
#ERROR : Can't open dsspfile "3bmoB.bssp"
#ERROR : Can't open dsspfile "3ch6E.bssp"
#ERROR : Can't open dsspfile "2ae1A.bssp"
#ERROR : Can't open dsspfile "3ek2A.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "2d1yA.bssp"
#ERROR : Can't open dsspfile "3d3wA.bssp"
#ERROR : Can't open dsspfile "2aqiA.bssp"
#ERROR : Can't open dsspfile "3ek2B.bssp"
#ERROR : Can't open dsspfile "2b35E.bssp"
#ERROR : Can't open dsspfile "3ctmF.bssp"
#ERROR : Can't open dsspfile "3d3eA.bssp"
#ERROR : Can't open dsspfile "3d5qC.bssp"
#ERROR : Can't open dsspfile "2b4qB.bssp"
#ERROR : Can't open dsspfile "3bzuB.bssp"
#ERROR : Can't open dsspfile "1cwuA.bssp"
#ERROR : Can't open dsspfile "2b37C.bssp"
#ERROR : Can't open dsspfile "3e03B.bssp"
#ERROR : Can't open dsspfile "3d5qD.bssp"
#ERROR : Can't open dsspfile "3ch6B.bssp"
#ERROR : Can't open dsspfile "1d7oA.bssp"
#ERROR : Can't open dsspfile "2belC.bssp"
#ERROR : Can't open dsspfile "2cfcA.bssp"
#ERROR : Can't open dsspfile "2dknA.bssp"
#ERROR : Can't open dsspfile "2b36B.bssp"
#ERROR : Can't open dsspfile "2d1yB.bssp"
#ERROR : Can't open dsspfile "3dwfB.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "1a9zA.bssp"
#ERROR : Can't open dsspfile "3ctmH.bssp"
#ERROR : Can't open dsspfile "3ek2C.bssp"
#ERROR : Can't open dsspfile "2bgkA.bssp"
#ERROR : Can't open dsspfile "2aqhA.bssp"
#ERROR : Can't open dsspfile "2ekpA.bssp"
#ERROR : Can't open dsspfile "2aq8A.bssp"
#ERROR : Can't open dsspfile "3czrA.bssp"
#ERROR : Can't open dsspfile "3ek2D.bssp"
#ERROR : Can't open dsspfile "2b35C.bssp"
#ERROR : Can't open dsspfile "3ch6D.bssp"
#ERROR : Can't open dsspfile "2b35F.bssp"
#ERROR : Can't open dsspfile "2e6gK.bssp"
#ERROR : Can't open dsspfile "3c6cA.bssp"
#ERROR : Can't open dsspfile "3e9qA.bssp"
#ERROR : Can't open dsspfile "2aqkA.bssp"
#ERROR : Can't open dsspfile "3diiA.bssp"
#ERROR : Can't open dsspfile "2d1yC.bssp"
#ERROR : Can't open dsspfile "3csdB.bssp"
#ERROR : Can't open dsspfile "2belD.bssp"
#ERROR : Can't open dsspfile "2a4kB.bssp"
#ERROR : Can't open dsspfile "2belB.bssp"
#ERROR : Can't open dsspfile "2a4kA.bssp"
#ERROR : Can't open dsspfile "2belA.bssp"
#ERROR : Can't open dsspfile "3edmB.bssp"
#ERROR : Can't open dsspfile "3ce6B.bssp"
#ERROR : Can't open dsspfile "2b35D.bssp"
#ERROR : Can't open dsspfile "2b35B.bssp"
#ERROR : Can't open dsspfile "2b37B.bssp"
#ERROR : Can't open dsspfile "2ag5A.bssp"
#ERROR : Can't open dsspfile "1dj2A.bssp"
#ERROR : Can't open dsspfile "2b4qA.bssp"
#ERROR : Can't open dsspfile "3c2qA.bssp"
#ERROR : Can't open dsspfile "2ag5B.bssp"
#ERROR : Can't open dsspfile "3e03A.bssp"
#ERROR : Can't open dsspfile "3e03C.bssp"
#ERROR : Can't open dsspfile "2ag5C.bssp"
#ERROR : Can't open dsspfile "3d5qA.bssp"
#ERROR : Can't open dsspfile "3ctmE.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "2dknB.bssp"
#ERROR : Can't open dsspfile "2e6hB.bssp"
#ERROR : Can't open dsspfile "3c2qB.bssp"
#ERROR : Can't open dsspfile "3ch6A.bssp"
#ERROR : Can't open dsspfile "2e6cC.bssp"
#ERROR : Can't open dsspfile "3dijA.bssp"
#ERROR : Can't open dsspfile "3byzA.bssp"
#ERROR : Can't open dsspfile "1auvA.bssp"
#ERROR : Can't open dsspfile "3d5qB.bssp"
#ERROR : Can't open dsspfile "3edmA.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "1dhrA.bssp"
#ERROR : Can't open dsspfile "3cxtA.bssp"
#ERROR : Can't open dsspfile "3bmeC.bssp"
#ERROR : Can't open dsspfile "2eghA.bssp"
#ERROR : Can't open dsspfile "1bmdA.bssp"
#ERROR : Can't open dsspfile "3ctmG.bssp"
#ERROR : Can't open dsspfile "3deyX.bssp"
#ERROR : Can't open dsspfile "2aw5B.bssp"
#ERROR : Can't open dsspfile "3e6vA.bssp"
#ERROR : Can't open dsspfile "3ctmA.bssp"
#ERROR : Can't open dsspfile "3cq0B.bssp"
#ERROR : Can't open dsspfile "3d4nB.bssp"
#ERROR : Can't open dsspfile "2cnbB.bssp"
#ERROR : Can't open dsspfile "3bzuA.bssp"
#ERROR : Can't open dsspfile "3ctmD.bssp"
#ERROR : Can't open dsspfile "3d4nD.bssp"
#ERROR : Can't open dsspfile "1c9yA.bssp"
#ERROR : Can't open dsspfile "3d4nC.bssp"
#ERROR : Can't open dsspfile "3d3uA.bssp"
#ERROR : Can't open dsspfile "2aw5C.bssp"
#ERROR : Can't open dsspfile "2d1yD.bssp"
#ERROR : Can't open dsspfile "3d7lA.bssp"
#ERROR : Can't open dsspfile "2ae2A.bssp"
#ERROR : Can't open dsspfile "3e9qB.bssp"
#ERROR : Can't open dsspfile "3cxrA.bssp"
#ERROR : Can't open dsspfile "1cydA.bssp"
#ERROR : Can't open dsspfile "3bhmA.bssp"
#ERROR : Can't open dsspfile "3bzuD.bssp"
#ERROR : Can't open dsspfile "2ekqD.bssp"
#ERROR : Can't open dsspfile "1edoA.bssp"
#ERROR : Can't open dsspfile "2ehdA.bssp"
#ERROR : Can't open dsspfile "2e6hD.bssp"
#ERROR : Can't open dsspfile "2c07A.bssp"
#ERROR : Can't open dsspfile "3bzuC.bssp"
#ERROR : Can't open dsspfile "3ce6D.bssp"
#ERROR : Can't open dsspfile "1e3wA.bssp"
#ERROR : Can't open dsspfile "3d7lD.bssp"
#ERROR : Can't open dsspfile "1e6wD.bssp"
#ERROR : Can't open dsspfile "1ae1B.bssp"
#ERROR : Can't open dsspfile "3edmC.bssp"
#ERROR : Can't open dsspfile "3d3eB.bssp"
#ERROR : Can't open dsspfile "3ctmB.bssp"
#ERROR : Can't open dsspfile "3dwfA.bssp"
#ERROR : Can't open dsspfile "3dwfC.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "3ctmC.bssp"
#ERROR : Can't open dsspfile "3bmnB.bssp"
#ERROR : Can't open dsspfile "2bfaB.bssp"
#ERROR : Can't open dsspfile "2bfoA.bssp"
#ERROR : Can't open dsspfile "3ce6A.bssp"
#ERROR : Can't open dsspfile "2c7vD.bssp"
#ERROR : Can't open dsspfile "1e6wB.bssp"
#ERROR : Can't open dsspfile "2c59B.bssp"
#ERROR : Can't open dsspfile "3d4nA.bssp"
#ERROR : Can't open dsspfile "1b8pA.bssp"
#ERROR : Can't open dsspfile "3bmiB.bssp"
#ERROR : Can't open dsspfile "2c7vA.bssp"
#ERROR : Can't open dsspfile "3bmoD.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "3bmfD.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "3edmD.bssp"
#ERROR : Can't open dsspfile "3bmoA.bssp"
#ERROR : Can't open dsspfile "2ehdB.bssp"
#ERROR : Can't open dsspfile "2cukA.bssp"
#ERROR : Can't open dsspfile "2c59A.bssp"
#ERROR : Can't open dsspfile "1e3sA.bssp"
#ERROR : Can't open dsspfile "2dteA.bssp"
#ERROR : Can't open dsspfile "1bhsA.bssp"
#ERROR : Can't open dsspfile "3bmkC.bssp"
#ERROR : Can't open dsspfile "1e6wA.bssp"
#ERROR : Can't open dsspfile "3bmeB.bssp"
#ERROR : Can't open dsspfile "3bmqC.bssp"
#ERROR : Can't open dsspfile "3bmdB.bssp"
#ERROR : Can't open dsspfile "3bmnD.bssp"
#ERROR : Can't open dsspfile "3bmnC.bssp"
#ERROR : Can't open dsspfile "2bfaA.bssp"
#ERROR : Can't open dsspfile "3bmfA.bssp"
#ERROR : Can't open dsspfile "1e6wC.bssp"
#ERROR : Can't open dsspfile "1di7A.bssp"
#ERROR : Can't open dsspfile "2c7vB.bssp"
#ERROR : Can't open dsspfile "2bfpB.bssp"
#ERROR : Can't open dsspfile "2dfdA.bssp"
#ERROR : Can't open dsspfile "3bmeA.bssp"
#ERROR : Can't open dsspfile "3bmqA.bssp"
#ERROR : Can't open dsspfile "2bf7A.bssp"
#ERROR : Can't open dsspfile "3bmfB.bssp"
#ERROR : Can't open dsspfile "2e6cD.bssp"
#ERROR : Can't open dsspfile "1e7wA.bssp"
#ERROR : Can't open dsspfile "2bd0A.bssp"
#ERROR : Can't open dsspfile "2a92C.bssp"
#ERROR : Can't open dsspfile "1di6A.bssp"
#ERROR : Can't open dsspfile "3d7lF.bssp"
#ERROR : Can't open dsspfile "2c7vC.bssp"
#ERROR : Can't open dsspfile "3bmjD.bssp"
#ERROR : Can't open dsspfile "2cnbA.bssp"
#ERROR : Can't open dsspfile "2e6bC.bssp"
#ERROR : Can't open dsspfile "2e6bD.bssp"
#ERROR : Can't open dsspfile "3bmoC.bssp"
#ERROR : Can't open dsspfile "3bmfC.bssp"
#ERROR : Can't open dsspfile "1a4uA.bssp"
#ERROR : Can't open dsspfile "3bmnA.bssp"
#ERROR : Can't open dsspfile "2bfmB.bssp"
#ERROR : Can't open dsspfile "2e6hC.bssp"
#ERROR : Can't open dsspfile "1d4gA.bssp"
#ERROR : Can't open dsspfile "1ek5A.bssp"
#ERROR : Can't open dsspfile "1e7wB.bssp"
#ERROR : Can't open dsspfile "1e92A.bssp"
#ERROR : Can't open dsspfile "3d64A.bssp"
#ERROR : Can't open dsspfile "3dfzA.bssp"
#ERROR : Can't open dsspfile "1c9kB.bssp"
#ERROR : Can't open dsspfile "2bfaC.bssp"
#ERROR : Can't open dsspfile "2e6eD.bssp"
#ERROR : Can't open dsspfile "3e48A.bssp"
#ERROR : Can't open dsspfile "2bf7B.bssp"
#ERROR : Can't open dsspfile "1dj3A.bssp"
#ERROR : Can't open dsspfile "3e8xA.bssp"
#ERROR : Can't open dsspfile "2aw5A.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "1e92B.bssp"
#ERROR : Can't open dsspfile "3dhnA.bssp"
#ERROR : Can't open dsspfile "1cbuC.bssp"
#ERROR : Can't open dsspfile "2bfaD.bssp"
#ERROR : Can't open dsspfile "2c5eB.bssp"
#ERROR : Can't open dsspfile "1c9kA.bssp"
#ERROR : Can't open dsspfile "3d7lB.bssp"
#ERROR : Can't open dsspfile "2c54B.bssp"
#ERROR : Can't open dsspfile "1c3vA.bssp"
#ERROR : Can't open dsspfile "2bf7D.bssp"
#ERROR : Can't open dsspfile "1a7aB.bssp"
#ERROR : Can't open dsspfile "2dt8A.bssp"
#ERROR : Can't open dsspfile "1b3rA.bssp"
#ERROR : Can't open dsspfile "2axqA.bssp"
#ERROR : Can't open dsspfile "1bdmB.bssp"
#ERROR : Can't open dsspfile "3dqpA.bssp"
#ERROR : Can't open dsspfile "2a92A.bssp"
#ERROR : Can't open dsspfile "1cg3A.bssp"
#ERROR : Can't open dsspfile "2e37E.bssp"
#ERROR : Can't open dsspfile "3bywC.bssp"
#ERROR : Can't open dsspfile "3bywD.bssp"
#ERROR : Can't open dsspfile "2c20A.bssp"
#ERROR : Can't open dsspfile "3dtdB.bssp"
#ERROR : Can't open dsspfile "3bywH.bssp"
#ERROR : Can't open dsspfile "1e92C.bssp"
#ERROR : Can't open dsspfile "1civA.bssp"
#ERROR : Can't open dsspfile "3bywF.bssp"
#ERROR : Can't open dsspfile "2bfmC.bssp"
#ERROR : Can't open dsspfile "1cg1A.bssp"
#ERROR : Can't open dsspfile "1e7qA.bssp"
#ERROR : Can't open dsspfile "2bfpD.bssp"
#ERROR : Can't open dsspfile "1e92D.bssp"
#ERROR : Can't open dsspfile "3bywB.bssp"
#ERROR : Can't open dsspfile "2bkaA.bssp"
#ERROR : Can't open dsspfile "1d0iA.bssp"
#ERROR : Can't open dsspfile "3dooA.bssp"
#ERROR : Can't open dsspfile "1a4iA.bssp"
#ERROR : Can't open dsspfile "2bfoC.bssp"
#ERROR : Can't open dsspfile "3e9nD.bssp"
#ERROR : Can't open dsspfile "2eggA.bssp"
#ERROR : Can't open dsspfile "3c0bC.bssp"
#ERROR : Can't open dsspfile "1d4fA.bssp"
#ERROR : Can't open dsspfile "2bf7C.bssp"
#ERROR : Can't open dsspfile "3e9nE.bssp"
#ERROR : Can't open dsspfile "3bywA.bssp"
#ERROR : Can't open dsspfile "2e6eB.bssp"
#ERROR : Can't open dsspfile "3e9nC.bssp"
#ERROR : Can't open dsspfile "3c3xA.bssp"
#ERROR : Can't open dsspfile "2ef0A.bssp"
#ERROR : Can't open dsspfile "3e9nA.bssp"

## Summary of PDB Search
:272
    3e-32  22%  1dohB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    1e-31  27%  2b35A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    5e-30  47%  1dfiA  [c.2.1] ENOYL ACYL CARRIER PROTEIN REDUCTASE
    9e-29  15%  3bmoB  [x.x.x] PTERIDINE REDUCTASE
    1e-27  12%  3ch6E  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    9e-27  21%  2ae1A  [x.x.x] TROPINONE REDUCTASE-II
    4e-26  51%  3ek2A  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    1e-25  50%  1c14A  [c.2.1] ENOYL REDUCTASE
    4e-25  28%  2d1yA  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    4e-25  22%  3d3wA  [x.x.x] L-XYLULOSE REDUCTASE
    5e-25  28%  2aqiA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    7e-25  51%  3ek2B  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    1e-24  27%  2b35E  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-24  23%  3ctmF  [x.x.x] CARBONYL REDUCTASE
    1e-24  12%  3d3eA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-24  12%  3d5qC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-24  21%  2b4qB  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    6e-24  12%  3bzuB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    8e-24  27%  1cwuA  [c.2.1] ENOYL ACP REDUCTASE
    1e-23  27%  2b37C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-23  17%  3e03B  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-23  13%  3d5qD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-23  14%  3ch6B  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-23  30%  1d7oA  [c.2.1] ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH)
    3e-23  15%  2belC  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-23  20%  2cfcA  [x.x.x] 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
    3e-23  18%  2dknA  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    4e-23  27%  2b36B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    6e-23  28%  2d1yB  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    7e-23  12%  3dwfB  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    7e-23  20%  1a27A  [c.2.1 (1i5rA)] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    9e-23  12%  1a9zA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    9e-23  20%  3ctmH  [x.x.x] CARBONYL REDUCTASE
    4e-22  52%  3ek2C  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    5e-22  21%  2bgkA  [x.x.x] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
    5e-22  27%  2aqhA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    6e-22  20%  2ekpA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    7e-22  28%  2aq8A  [x.x.x] ENOYL-ACYL-CARRIER-PROTEIN REDUCTASE
    1e-21  13%  3czrA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-21  51%  3ek2D  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    3e-21  26%  2b35C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-20  12%  3ch6D  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-20  27%  2b35F  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-20   9%  2e6gK  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-20  19%  3c6cA  [x.x.x] 3-KETO-5-AMINOHEXANOATE CLEAVAGE ENZYME
    3e-20  15%  3e9qA  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    3e-20  29%  2aqkA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-20  20%  3diiA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    4e-20  28%  2d1yC  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    5e-20  20%  3csdB  [x.x.x] PUTATIVE KETOACYL REDUCTASE
    9e-20  11%  2belD  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    9e-20  29%  2a4kB  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    1e-19  12%  2belB  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-19  26%  2a4kA  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    2e-19  14%  2belA  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-19  18%  3edmB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    3e-19   8%  3ce6B  [x.x.x] ADENOSYLHOMOCYSTEINASE
    3e-19  28%  2b35D  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-19  27%  2b35B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    5e-19  28%  2b37B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    8e-19  25%  2ag5A  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    9e-19  11%  1dj2A  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    1e-18  20%  2b4qA  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    2e-18  12%  3c2qA  [x.x.x] UNCHARACTERIZED CONSERVED PROTEIN
    2e-18  26%  2ag5B  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    2e-18  17%  3e03A  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-18  16%  3e03C  [x.x.x] SHORT CHAIN DEHYDROGENASE
    3e-18  25%  2ag5C  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    4e-18  12%  3d5qA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-18  19%  3ctmE  [x.x.x] CARBONYL REDUCTASE
    5e-18  29%  1ahhA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    7e-18  18%  2dknB  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    7e-18   8%  2e6hB  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-17  12%  3c2qB  [x.x.x] UNCHARACTERIZED CONSERVED PROTEIN
    2e-17  12%  3ch6A  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-17  12%  2e6cC  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-17  20%  3dijA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    4e-17  11%  3byzA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-17  11%  1auvA  [c.30.1 - d.142.1] SYNAPSIN IA
    6e-17  12%  3d5qB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    8e-17  24%  3edmA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    8e-17  20%  1dohA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    1e-16  13%  1dhrA  [c.2.1 (1dirA)] DIHYDROPTERIDINE REDUCTASE
    1e-16  23%  3cxtA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    1e-16  16%  3bmeC  [x.x.x] PTERIDINE REDUCTASE
    2e-16  12%  2eghA  [x.x.x] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
    2e-16  13%  1bmdA  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    2e-16  22%  3ctmG  [x.x.x] CARBONYL REDUCTASE
    3e-16  19%  3deyX  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 1
    4e-16  12%  2aw5B  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    7e-16  13%  3e6vA  [x.x.x] ARGINASE-1
    8e-16  19%  3ctmA  [x.x.x] CARBONYL REDUCTASE
    8e-16   5%  3cq0B  [x.x.x] PUTATIVE TRANSALDOLASE YGR043C
    9e-16  12%  3d4nB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-15   9%  2cnbB  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    1e-15  12%  3bzuA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-15  18%  3ctmD  [x.x.x] CARBONYL REDUCTASE
    1e-15  14%  3d4nD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-15   8%  1c9yA  [c.78.1 - c.78.1] ORNITHINE CARBAMOYLTRANSFERASE
    3e-15  12%  3d4nC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-15   9%  3d3uA  [x.x.x] 4-HYDROXYBUTYRATE COA-TRANSFERASE
    4e-15  10%  2aw5C  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    4e-15  28%  2d1yD  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    5e-15  17%  3d7lA  [x.x.x] LIN1944 PROTEIN
    6e-15  20%  2ae2A  [c.2.1] PROTEIN (TROPINONE REDUCTASE-II)
    7e-15  13%  3e9qB  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    7e-15  20%  3cxrA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    1e-14  19%  1cydA  [c.2.1] CARBONYL REDUCTASE
    1e-14  13%  3bhmA  [x.x.x] CARBONYL REDUCTASE [NADPH] 1
    2e-14  14%  3bzuD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-14  23%  2ekqD  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    3e-14  21%  1edoA  [c.2.1] BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
    3e-14  17%  2ehdA  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    5e-14  11%  2e6hD  [x.x.x] 5'-NUCLEOTIDASE SURE
    6e-14  24%  2c07A  [x.x.x] 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE
    8e-14  15%  3bzuC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-13  14%  3ce6D  [x.x.x] ADENOSYLHOMOCYSTEINASE
    1e-13  15%  1e3wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    2e-13  18%  3d7lD  [x.x.x] LIN1944 PROTEIN
    2e-13  14%  1e6wD  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    3e-13  16%  1ae1B  [c.2.1] TROPINONE REDUCTASE-I
    3e-13  18%  3edmC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    3e-13  11%  3d3eB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    6e-13  17%  3ctmB  [x.x.x] CARBONYL REDUCTASE
    8e-13  18%  3dwfA  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    1e-12  19%  3dwfC  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    1e-12  16%  1ae1A  [c.2.1] TROPINONE REDUCTASE-I
    1e-12  19%  3ctmC  [x.x.x] CARBONYL REDUCTASE
    1e-12  16%  3bmnB  [x.x.x] PTERIDINE REDUCTASE
    2e-12  20%  2bfaB  [x.x.x] PTERIDINE REDUCTASE 1
    2e-12  20%  2bfoA  [x.x.x] PTERIDINE REDUCTASE 1
    3e-12   8%  3ce6A  [x.x.x] ADENOSYLHOMOCYSTEINASE
    3e-12  15%  2c7vD  [x.x.x] PTERIDINE REDUCTASE
    4e-12  15%  1e6wB  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    4e-12   8%  2c59B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    4e-12  12%  3d4nA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-12   9%  1b8pA  [c.2.1 - d.162.1] PROTEIN (MALATE DEHYDROGENASE)
    4e-12  16%  3bmiB  [x.x.x] PTERIDINE REDUCTASE
    6e-12  16%  2c7vA  [x.x.x] PTERIDINE REDUCTASE
    6e-12  17%  3bmoD  [x.x.x] PTERIDINE REDUCTASE
    6e-12  12%  1a9yA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    7e-12  16%  3bmfD  [x.x.x] PTERIDINE REDUCTASE
    8e-12  15%  1bdbA  [x.x.x] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    9e-12  21%  3edmD  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-11  18%  3bmoA  [x.x.x] PTERIDINE REDUCTASE
    1e-11  17%  2ehdB  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    1e-11   8%  2cukA  [x.x.x] GLYCERATE DEHYDROGENASE/GLYOXYLATE REDUCTASE
    1e-11   9%  2c59A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-11  16%  1e3sA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    2e-11  15%  2dteA  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    2e-11  18%  1bhsA  [c.2.1 (1dhtA)] 17BETA-HYDROXYSTEROID DEHYDROGENASE
    2e-11  15%  3bmkC  [x.x.x] PTERIDINE REDUCTASE
    2e-11  13%  1e6wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    3e-11  15%  3bmeB  [x.x.x] PTERIDINE REDUCTASE
    3e-11  16%  3bmqC  [x.x.x] PTERIDINE REDUCTASE
    3e-11  16%  3bmdB  [x.x.x] PTERIDINE REDUCTASE
    3e-11  16%  3bmnD  [x.x.x] PTERIDINE REDUCTASE
    4e-11  19%  3bmnC  [x.x.x] PTERIDINE REDUCTASE
    4e-11  22%  2bfaA  [x.x.x] PTERIDINE REDUCTASE 1
    6e-11  16%  3bmfA  [x.x.x] PTERIDINE REDUCTASE
    6e-11  15%  1e6wC  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    7e-11   9%  1di7A  [c.57.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    8e-11  14%  2c7vB  [x.x.x] PTERIDINE REDUCTASE
    9e-11  19%  2bfpB  [x.x.x] PTERIDINE REDUCTASE 1
    1e-10   9%  2dfdA  [x.x.x] MALATE DEHYDROGENASE
    1e-10  15%  3bmeA  [x.x.x] PTERIDINE REDUCTASE
    1e-10  15%  3bmqA  [x.x.x] PTERIDINE REDUCTASE
    2e-10  19%  2bf7A  [x.x.x] PTERIDINE REDUCTASE 1
    2e-10  14%  3bmfB  [x.x.x] PTERIDINE REDUCTASE
    3e-10  11%  2e6cD  [x.x.x] 5'-NUCLEOTIDASE SURE
    3e-10  16%  1e7wA  [c.2.1] PTERIDINE REDUCTASE
    3e-10  17%  2bd0A  [x.x.x] SEPIAPTERIN REDUCTASE
    4e-10   8%  2a92C  [x.x.x] L-LACTATE DEHYDROGENASE
    4e-10   9%  1di6A  [c.57.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    5e-10  18%  3d7lF  [x.x.x] LIN1944 PROTEIN
    5e-10  16%  2c7vC  [x.x.x] PTERIDINE REDUCTASE
    5e-10  15%  3bmjD  [x.x.x] PTERIDINE REDUCTASE
    6e-10  12%  2cnbA  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    6e-10  10%  2e6bC  [x.x.x] 5'-NUCLEOTIDASE SURE
    8e-10  10%  2e6bD  [x.x.x] 5'-NUCLEOTIDASE SURE
    9e-10  15%  3bmoC  [x.x.x] PTERIDINE REDUCTASE
    9e-10  15%  3bmfC  [x.x.x] PTERIDINE REDUCTASE
    9e-10  12%  1a4uA  [c.2.1] ALCOHOL DEHYDROGENASE
    1e-09  16%  3bmnA  [x.x.x] PTERIDINE REDUCTASE
    2e-09  18%  2bfmB  [x.x.x] PTERIDINE REDUCTASE 1
    2e-09  12%  2e6hC  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-09  12%  1d4gA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    3e-09  13%  1ek5A  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    3e-09  20%  1e7wB  [c.2.1] PTERIDINE REDUCTASE
    3e-09  23%  1e92A  [c.2.1] PTERIDINE REDUCTASE 1
    3e-09   8%  3d64A  [x.x.x] ADENOSYLHOMOCYSTEINASE
    3e-09  12%  3dfzA  [x.x.x] PRECORRIN-2 DEHYDROGENASE
    4e-09   8%  1c9kB  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    6e-09  23%  2bfaC  [x.x.x] PTERIDINE REDUCTASE 1
    1e-08  12%  2e6eD  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-08   6%  3e48A  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    1e-08  16%  2bf7B  [x.x.x] PTERIDINE REDUCTASE 1
    2e-08   9%  1dj3A  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    2e-08  19%  3e8xA  [x.x.x] PUTATIVE NAD-DEPENDENT EPIMERASE/DEHYDRATASE
    2e-08  10%  2aw5A  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    3e-08  15%  1bxkA  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    3e-08  19%  1e92B  [c.2.1] PTERIDINE REDUCTASE 1
    3e-08  10%  3dhnA  [x.x.x] NAD-DEPENDENT EPIMERASE/DEHYDRATASE
    4e-08  11%  1cbuC  [c.37.1] ADENOSYLCOBINAMIDE KINASE/ADENOSYLCOBINAMIDE
    4e-08  22%  2bfaD  [x.x.x] PTERIDINE REDUCTASE 1
    6e-08   9%  2c5eB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    7e-08   8%  1c9kA  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    8e-08  19%  3d7lB  [x.x.x] LIN1944 PROTEIN
    1e-07   8%  2c54B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-07   7%  1c3vA  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    1e-07  21%  2bf7D  [x.x.x] PTERIDINE REDUCTASE 1
    1e-07   8%  1a7aB  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    1e-07  12%  2dt8A  [x.x.x] DEGV FAMILY PROTEIN
    2e-07  12%  1b3rA  [c.23.12 - c.2.1] PROTEIN (S-ADENOSYLHOMOCYSTEINE HYDROLASE)
    4e-07  12%  2axqA  [x.x.x] SACCHAROPINE DEHYDROGENASE
    4e-07  13%  1bdmB  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    5e-07  11%  3dqpA  [x.x.x] OXIDOREDUCTASE YLBE
    8e-07  10%  2a92A  [x.x.x] L-LACTATE DEHYDROGENASE
    1e-06   9%  1cg3A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    2e-06  11%  2e37E  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-06  16%  3bywC  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    2e-06  15%  3bywD  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    3e-06  12%  2c20A  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    4e-06   6%  3dtdB  [x.x.x] INVASION-ASSOCIATED PROTEIN B
    5e-06  13%  3bywH  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    5e-06  21%  1e92C  [c.2.1] PTERIDINE REDUCTASE 1
    5e-06  14%  1civA  [c.2.1 - d.162.1] NADP-MALATE DEHYDROGENASE
    8e-06  13%  3bywF  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    1e-05  18%  2bfmC  [x.x.x] PTERIDINE REDUCTASE 1
    1e-05   8%  1cg1A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    2e-05   8%  1e7qA  [c.2.1] GDP-FUCOSE SYNTHETASE
    2e-05  20%  2bfpD  [x.x.x] PTERIDINE REDUCTASE 1
    2e-05  19%  1e92D  [c.2.1] PTERIDINE REDUCTASE 1
    2e-05  16%  3bywB  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    3e-05  12%  2bkaA  [x.x.x] TAT-INTERACTING PROTEIN TIP30
    4e-05   9%  1d0iA  [c.23.13] TYPE II 3-DEHYDROQUINATE HYDRATASE
    4e-05  10%  3dooA  [x.x.x] SHIKIMATE DEHYDROGENASE
    4e-05  11%  1a4iA  [c.58.1 - c.2.1] METHYLENETETRAHYDROFOLATE DEHYDROGENASE /
    5e-05  18%  2bfoC  [x.x.x] PTERIDINE REDUCTASE 1
    7e-05  27%  3e9nD  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    1e-04   5%  2eggA  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    2e-04  11%  3c0bC  [x.x.x] CONSERVED ARCHAEAL PROTEIN Q6M145
    2e-04  12%  1d4fA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    2e-04  26%  2bf7C  [x.x.x] PTERIDINE REDUCTASE 1
    2e-04  28%  3e9nE  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    2e-04  15%  3bywA  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    3e-04  10%  2e6eB  [x.x.x] 5'-NUCLEOTIDASE SURE
    4e-04  35%  3e9nC  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    4e-04  11%  3c3xA  [x.x.x] EUGENOL SYNTHASE 1
    6e-04   9%  2ef0A  [x.x.x] ORNITHINE CARBAMOYLTRANSFERASE
    7e-04  20%  3e9nA  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
:272

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAQASGLMAGKRGLIMGVANNRSIAWGIAKACADAGAELALTWQGDALKKRVEPLAQELGAFMAGHCDVT
1dohB           LGPQSASLEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAAIKKNGSDAACVKANVG
2b35A           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLIQRITDRLPAKAPLLELDVQNEE
1dfiA           -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
3bmoB           -------MEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSTAVVCQADLT
3ch6E           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
2ae1A           ---GRWNLEGCTALVTGGS--RGIGYGIVEELASLGASVYTCRNQKELNDCLTQWRSKGFKVEASVCDLS
3ek2A           -----GFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSELVFPCDVA
1c14A           -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
2d1yA           -----GLFAGKGVLVTGGA--RGIGRAIAQAFAREGALVALCDLRPE---GKEVAEAIGGAFFQ--VDLE
3d3wA           ----ELFLAGRRVLVTGAGK------GIGRGTVQALHATGARVVAVS---RTQADLDSLVRECPGIEPVC
2aqiA           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLTQRITDRLPAKAPLLELDVQNEE
3ek2B           -----GFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSELVFPCDVA
2b35E           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLEVQNEE
3ctmF           -----FSLKGKVASVTGSSGG--IGWAVAEAYAQAGADVAIWYSHPADEKAEHLQKTYGVHSKAYKCNIS
3d3eA           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
3d5qC           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
2b4qB           -------LAGRIALVTGGS--RGIGQMIAQGLLEAGARVFICARDAEACADTATRLSAYGDCQAIPADLS
3bzuB           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
1cwuA           ----PIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGS
2b37C           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLLIQRITDRLPAKAPLELDVQNEE
3e03B           -------LSGKTLFITGAS--RGIGLAIALRAARDGANVAIAAKSAVANPKLPGTIHSAAAALALKCDIR
3d5qD           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
3ch6B           -----EMLQGKKVIVTGAS--KGIGREMAYHLAKMGAHVVVTSKETLQKVVSHCLELGAASAHYIAGTME
1d7oA           ----PIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILGTWVPALNIFETSLRRGKFDQKANKRYAGS
2belC           MEFRPEMLQGKKVIVTGASKG--IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLGAASAHYIAGTME
2cfcA           ----------RVAIVTGAS--SGNGLAIATRFLARGDRVAALDAETLEETARTHWHAYADKVLRVRADVA
2dknA           ---------------------------LKELLARAGHTVIGIRGQADIEADLSTPGGRETAAVLDRCGGV
2b36B           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLEVQNEE
2d1yB           -----GLFAGKGVLVTGGA--RGIGRAIAQAFAREGALVALCDLRPE---GKEVAEAIGGAFFQ--VDLE
3dwfB           -----EMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSME
1a27A           --------ARTVVLITGCS--SGIGLHLAVRLASDPSQSFKVYDLKTQGRLWEAARALACPPGSLETLQL
1a9zA           -----------RVLVTGGS--GYIGSHTCVQLLQNGHDVIILDLCNSKRSVLPVIERLGGKHPTFVEGDI
3ctmH           -----FSLKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQ-KTYGVHSKAYKCNIS
3ek2C           -----GFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSELVFPCDVA
2bgkA           ----TNRLQDKVAIITGGAGG--IGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVT
2aqhA           ----TGLLDGKRILVSGIITDSSVAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAPLLELDVQNEE
2ekpA           ----------RKALVTGGS--RGIGRAIAEALVARGYRVAIASRNPEEAAQSLGA----VPLPTDLEKDD
2aq8A           -----GLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLIQRITDRLPAKAPLLELDVQNEE
3czrA           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
3ek2D           -----GFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSELVFPCDVA
2b35C           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLDVQNEE
3ch6D           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
2b35F           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELQNEE
2e6gK           -------------------------------------------------------GIYSPGLWALAEAAS
3c6cA           ----------------------------------------------------------------------
3e9qA           -----DLLNDRIILVTGAS--DGIGREAATYARYGATVILLGRNEEKLRQVASHINEETPQWFILDLLTC
2aqkA           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLIQRITDRLPAKAPLLELDVQNEE
3diiA           -----------RGVIV-TGGGHGIGKQICLDFLEAGDKVCFI---DIDEKRSADFAKERPNLFYFHGDVA
2d1yC           -----GLFAGKGVLVTGGA--RGIGRAIAQAFAREGALVALCDLRPE---GKEVAEAIGGAFFQ--VDLE
3csdB           -----ATQDSEVALVTGAT--SGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEDGRTCDVR
2belD           MEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
2a4kB           -------LSGKTILVTGAA--SGIGRAALDLFAREGASLVAVDREERL--LAEAVAALEAEAIAVVADVS
2belB           ----PEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
2a4kA           -----GRLSGKTILVTGAA--SGIGRAALDLFAREGASLVAVDREERL--LAEAVAALEAEAIAVVADVS
2belA           ------MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
3edmB           -------FTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVAEIEKLGRSALAIKADLT
3ce6B           ----------IGGKKVLICGYGDVGKGCAEAMKGQGARVSVTEIDPINAMMEGFDVVTVEEAIGDADIVV
2b35D           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELQNEE
2b35B           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLDVQNEE
2b37B           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELQNEE
2ag5A           -----GRLDGKVIILTAAA--QGIGQAAALAFAREGAKVIAT---DINESKLQELEKYPGIQ-TRVLDVT
1dj2A           -------SELAKSFIGT--TKRGIGPAYSSKVIRNGIRVGDLRHMDTLPQ--KLDLLLSDAAARFQGFKY
2b4qA           -------LAGRIALVTGGS--RGIGQMIAQGLLEAGARVFICARDAEACADTATRLSAYGDCQAIPADLS
3c2qA           --------GGPALAKVELGYIQAILAGNALATHDIESALYGTSLGVNIKTAKPVTGGHKHHI-YAINAIN
2ag5B           -----GRLDGKVIILTAAA--QGIGQAAALAFAREGAKVIAT---DINESKLQELEKYPGIQ-TRVLDVT
3e03A           -------LSGKTLFITGAS--RGIGLAIALRAARDGANVAIAAKSAVANPKLPGTIHSAAAALALKCDIR
3e03C           -------LSGKTLFITGAS--RGIGLAIALRAARDGANVAIAAKSAVANPKLPGTIHSAAAALALKCDIR
2ag5C           -----GRLDGKVIILTAAA--QGIGQAAALAFAREGAKVIAT---DINESKLQELEKYPGIQ-TRVLDVT
3d5qA           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
3ctmE           -------LKGKVASVTGSSGGIGWAVAEAYAQAGAD-VAIWYNSHPADEKAEHLQKTYGVHSKAYKCNIS
1ahhA           ---------------------------IAITFATAGASVVVSINADAANHVVDEIQQLGGQAFACRCDIT
2dknB           ---------------------------LKELLARAGHTVIGIDRGQA---DIEADLSTPGGETAVAAVLD
2e6hB           ------------------------------------------------------------------EAAS
3c2qB           ---------GGGPALAKVELIQAILAGNALATHDIESALYGTSLGVNIKTAKPV-TGGHKHHIYAINAIN
3ch6A           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
2e6cC           ---------------------------------------------PGLWALAEAASQFGEVF-VAAPDTE
3dijA           -----------RGVIV-TGGGHGIGKQICLDFLEAGDKVCFI---DIDEKRSADFAKERPNLFYFHGDVA
3byzA           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
1auvA           ---------AARVLLVI-DEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDEVLRNGV
3d5qB           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
3edmA           -------FTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVAEIEKLGRSALAIKADLT
1dohA           LGPQSASLEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAAIKKNGSDAACVKANVG
1dhrA           ---------ARRVLVYGGR--GALGSRCVQAFRARNWWVASIDV------VENEEASASVIVKMTDSFTE
3cxtA           -----FSLKGKIALVTGASYGIGFAIASAYAKAGATI-VFNDINQELVDRGMAAYKAAGINAHGYVCDVT
3bmeC           ----------PAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHYHNSAAVSLADELNKERSNTAVVQADLT
2eghA           ---------GKQLTILGST--GSIGCSTLDVVRHNPEH---FRVVALVAGKNVTRMVEQCEFSPRYAVMD
1bmdA           ---------PVRVAVTGAA--GQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAF
3ctmG           -----FSLKGKVASVTGSSGG--IGWAVAEAYAQAGADVAIWYSHPADEKAEHLQKTYGVHSKAYKCNIS
3deyX           --------ARTVVLITGCS--SGIGLHLAVRLASDPSQSFKVYATGRLWEAARALACPPGSLETLQLDVR
2aw5B           ---ITKNKLSDQTILFQ--GAGEAALGIAHLIVMALEKEGLPKEKAI--KKIWLVDSKGLIVKGQEKEKF
3e6vA           GKVAEVKKNGRISLVLG--GDHSLAIGSISGHARVHPDLGVIWVDA------HTDINTPLTTTSGNLHGQ
3ctmA           -----FSLKGKVASVTGSSGGIGWAVAEAYAQAGA-DVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNIS
3cq0B           -------LILAASKLEKYA--RFIDAAVEYGRKHGKTDHEKIEMDKILVEFGTQILKVVPGRVSTEVDAR
3d4nB           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
2cnbB           --------SHMRVLVCGGA--GYIGSHFVRALLRDTNHSVVIVSLVGTHGKSDHVETRENWADRYAALEV
3bzuA           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
3ctmD           -----FSLKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKA-----------EHLQKTYGV
3d4nD           LNERPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
1c9yA           --------------LSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDAS--------VTKLAEQYAK
3d4nC           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
3d3uA           ---------------DEPIAEVLPGSDLELRIGQNCASLIKDGDTLQLGIGGIPDAVLRALEGH--KDLG
2aw5C           -------------------------GEAALGIAHVMALEKEGLPKEKAIKKIWLVDSKGLIVKGQEKEKF
2d1yD           ------LFAGKGVLVTGGA--RGIGRAIAQAFAREGALVALCDLRPE---GKEVAEAIGGAFFQ--VDLE
3d7lA           -------------------------------------------------------------TAGRHSGDV
2ae2A           ---GRWNLEGCTALVTGGS--RGIGYGIVEELASLGASVYTCSRNQK--ELNDCLTQWRSKGFKVEASVC
3e9qB           ---KQDLLNDRIILVTGAS--DGIGREAATYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFILDL
3cxrA           FSLDQFSLKGKIALVTGAS--YGIGFAIASAYAK---AGATIVFNDINQELVDRGMAAYKAAGINAHGYV
1cydA           -------FSGLRALVTGAGKGIGRDTVKALHA----------SGAKVVAVTRTNSDLVSLAKECPGIEPV
3bhmA           ---------IHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDID
3bzuD           -----EMLQGKKVIVTGAS--KGIGREMAYHLAKMGAHVVVTARETLQKVVSHCLELGAASAHYIAGTME
2ekqD           ----------RKALVTGGS--RGIGRAIAEALVARGYRVAIASRNPEEAAQ----SLGAVPLPTDLEKDD
1edoA           ----------PVVVVTGAS--RGIGKAIALSLGKAGCKVLVNYSAKAAEEVSKQIEAYGGQAITFGGDVS
2ehdA           ----------GAVLITGAS--RGIGEATARLLHAKGYRVGLMARDEK---RLQALAAELEGALPLPGDVR
2e6hD           --------------------------------------ILVTNDDGIYSPGLWALAEAASQVFVAAPDTA
2c07A           -------GENKVALVTGAG--RGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDV
3bzuC           -----EMLQGKKVIVTGASKG--IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGT
3ce6D           -----------------------VGKGCAEAMKGQGARVSVTDPINALQAMMEGFDVVTVEEAIGDDIVV
1e3wA           -------VKGLVAVITGGA--SGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSE
3d7lD           ----------------------------------------------------------------------
1e6wD           -------VKGLVAVITGGA--SGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSE
1ae1B           -------LKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVEGSVCDLLS
3edmC           -------FTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVAEIEKLGRSALAIKADLT
3d3eB           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
3ctmB           -----FSLKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKA-----------EHLQKTYGV
3dwfA           ------MLQGKKVIVTGAS--KGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAAHYIAGSME
3dwfC           ------MLQGKKVIVTGAS--KGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAAHYIAGSME
1ae1A           -------LKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVEGSVCDLLS
3ctmC           -----FSLKGKVASVTGSSGGIGWAVAEAYAQAGADV-AIWYNSHPADEKAEHLQKTYGVHSKAYKCNIS
3bmnB           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHYHNSAADELNKERSNTAVVCQADLTNSN
2bfaB           -------------LVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSRRPNSAITVQADLSNVATAPAPVT
2bfoA           -------------LVTGAA--KRLGRSIAEGLHAEGYAVCLHYNARRPNSAITVQADLSNVATAPVAPVT
3ce6A           -----------------ICGYGDVGKGCAEAMKGQGARVSVTIDPINALQAMMEGFDVVTEAIGDADIVV
2c7vD           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNVVQADLT
1e6wB           -------VKGLVAVITGGA--SGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSE
2c59B           -------SENLKISITGAG--GFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENC
3d4nA           -----EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTME
1b8pA           ---------PMRVAVTGAA--GQICYSLLFRIANGDMLGKDQPLQLLEIPNEKAQKALQGVMMEIDDCAF
3bmiB           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHSAEAAVSLADELNKERSNTAVVCQADLT
2c7vA           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHYHNSAAVSLADELNKERSNTAVVQADLT
3bmoD           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERAVVCQADLT
1a9yA           ----------------------------------------------------------------------
3bmfD           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHSAEAAVSLADELNKERSNTAVVCQADLT
1bdbA           -------LKGEAVLITGGA--SGLGRALVDRFVAEGAKVAVLDKSAERLAELETDHGDNVLGIVGDVRSL
3edmD           -------FTNRTIVVAGAG--RDIGRACAIRFAQEGANVVLTYNGAGAATAVAEIEKLGRSALAIKADLT
3bmoA           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHSAEAAVSLADELNKERSNTAVVCQADLT
2ehdB           -------GMKGAVLITGAS------RGIGEATARLLHAKGYRVGLMARDERLQALAAELEGALPLPGDVR
2cukA           -----------QGLTLGLVGMGRIGQAVAKRALAFGMRVVYHATPKPLPYPFLSLEELLKEADVVSLHTP
2c59A           -------SENLKISITGAG--GFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENC
1e3sA           -------VKGLVAVITGGA--SGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSE
2dteA           ----FSDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGE------------AKYDHIECDVT
1bhsA           --------ARTVVLITGCS--SGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSLE
3bmkC           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHSAEAAVSLADELNKERSNTAVVCQADLT
1e6wA           -------VKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKE
3bmeB           ---------APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLT
3bmqC           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHSAEAAVSLADELNKERSNTAVVCQADLT
3bmdB           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVYHNSAEAAVSLADELNKERSNTAVVCQADLT
3bmnD           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHSAEAAVSLADELNKERSNTAVVCQADLT
3bmnC           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHSAEAAVSLADELNKERSNTAVVCQADLT
2bfaA           -------------LVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSAAEANAITVQADLSNVATAPAPVT
3bmfA           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQA
1e6wC           -------VKGLVAVITGGA--SGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSE
1di7A           ------------------------------ATLRIGLVSIS---DRYQDKGIPALEEWLTSALTTTRLIP
2c7vB           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQAD
2bfpB           ---------VPVALVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQA
2dfdA           ----------AKVAVLGAS--GGIGQPLSLLLKNSPLVSRLTL-------YDIAHTPGVAADLSHIETKA
3bmeA           ---------APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLT
3bmqA           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHSAEAAVSLADELNKERSNTAVVCQADLT
2bf7A           -------------LVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQA
3bmfB           ---------APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCADLT
2e6cD           --------------------------------------ILVTNDDGIYSPGLWALAEAASQFVFVAAPDT
1e7wA           ---------VPVALVTGAAKAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPVSSA
2bd0A           ----------HILLITGAG--KGIGRAIALEFARAARHHPSSRTAADLEKISLECRAEGALTDTITADIS
2a92C           ---------PKPKIVLVGS--GMIGGVMATLIVQKNLGDVVMFVVKNMPQGKALDTSHSNVMAYSNCKVT
1di6A           --------------LVSISDRDKGIPALEEWLTSALTTPFELET---------------------RLIPD
3d7lF           ----------------------------------------------------------------------
2c7vC           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELERSNTAVVQADLT
3bmjD           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHSAEAAVSLADELNKERSNTAVVCQADLT
2cnbA           --------SHMRVLVCGGA--GYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHVETRENAALEVGDVR
2e6bC           --------------------------------------ILVTNDDGIYSPGLWALAEAASQVFVAAPDTH
2e6bD           --------------------------------------ILVTNDDGIYSPGLWALAEAASQFVFVAAPDT
3bmoC           ---------APAAVVTGAA--KRIGRAIAVKLHQTGYRVVIHSAEAAVSLADELNKERSNTAVVCQADLT
3bmfC           ---------APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSAVVCQADLTN
1a4uA           -------LTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVT
3bmnA           ---------APAAVVTGAA--KRIGRAIAVKLHQTGVIHYHNSAEAAVSLADELNKERSNTAVVCQADLT
2bfmB           -------------LVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQA
2e6hC           ---------------------------------------------PGLWALAEAASQFGEVFVA--APDG
1d4gA           ---------------AVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVDEACKEGNIFV
1ek5A           ---------AEKVLVTGGA--GYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSV
1e7wB           -------------LVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSNARRPNSAITVQADLSNVATAPVT
1e92A           ----------------------------------------------------------------------
3d64A           IKRATDVMIAGKIAVVA--GYGDVGKGCAQSLRGLGATVWVTEIDPICALQAAMEGYRVVTMEYAADKAD
3dfzA           MYTVMLDLKGRSVLVVGGGT---IATRRIKGFLQEGAAITVVAPTVSAEINEWEAKGQLRVKRKKVGEED
1c9kB           --------------------ARSGKSRHAEALIGDAPQVLYIASQILDDEMAARIQHHKDGRPAHWRTAE
2bfaC           -------------LVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSRRPNSAITVQADLSNVATAPAPVT
2e6eD           --------------------------------------------SPGLWALAEAASQFGEVF-VAAPDIA
3e48A           -------------ILTGAT--GHLGTHITNQAIANHIDHFHI---GVRNVEKVPDDWRGKV-SVRQLDYF
2bf7B           ---------VPVALVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQA
1dj3A           -------AELANSFIGTTK--RGIGPCYSSKVTRNGLRVCDL---RHMDTFGDKLDVLFEDAAAFEGFKY
3e8xA           ----------------------------------------------------------------------
2aw5A           -------ITKNSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLV--DSKGLIVKGQEKEKF
1bxkA           ----------RKILITGGA--GFIGSALVRYIINETSDA---VVVVDKLTYAGNLMSLAPVAQSERFAFE
1e92B           ---------VPVALVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQA
3dhnA           ------------------------------------------------------LLNEALNRGFEVTAVV
1cbuC           -------------LVTGGA--RSGKSRHAEALIGDAPQVLYIATSQILDDEMAARIQHHDGRPAHWRTAE
2bfaD           -------------LVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSAAEANAITVQADLSNVATAPAPVT
2c5eB           -------SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENCLK
1c9kA           --------------------ARSGKSRHAEALIGDAPQVLYIATSQIARIQHH-------KDGRPAHWRT
3d7lB           ----------------------------------------------------------------------
2c54B           -------SENLKISITGAG--GFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENC
1c3vA           --------------------------KVGTTMVRAVAAA---DDLTLSAELDAGDPLSLLTDGNTEVVID
2bf7D           ----------------------------------------------------------------------
1a7aB           -------TDVIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAEGYEVTTDEAQEGNIFV
2dt8A           ----------RITLVTDST--SDLPQDLRGRLGVRVVPLYVNLSGDWEEITPTEIFQKVREGAFPTTSQP
1b3rA           -------DVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPLQAAMEGYEVTTMDEACKEGNIFV
2axqA           ---------GKNVLLLG-------SGFVAQPVIDTLAANDDINV------TVACRTLANAQALAKPSGSK
1bdmB           ----------------------------------------------------------------------
3dqpA           ----------------------------------------------------------------------
2a92A           ---------PKPKIVLVGS--GMIGGVMATLIVQKNLGDVVMFDVVNMPQGKALDTSHSNVMAYSNCKVT
1cg3A           -------REKARGAKAIGTTGRGIGPAYEDKVALRGLRVGDLFDKETFAEKLKEVMEYHNYYKAEAVDYQ
2e37E           --------------------GVGSATAYALALLGVAREVVLVLDRKLAQAHAEDILHATPFAHPVWVRAG
3bywC           ---------QDLILGTLPA--NSEDAGARGLFVRANDDGLQIHGELVLDLSKRELAQLPADATIAISATE
3bywD           ---------QDLILGTLPA--NSEDAGARGLFVRANDDGLQIHGELVLDLSKRELAQLPADATIAISATE
2c20A           -------------LICGGA--GYIGSHAVKKLVDEGLSVVVVDNLQTGHEDA---------ITEGAKFYN
3dtdB           ---------------------------------------------------NCGIQEGKKVCFMHRQEVN
3bywH           ---------QDLILGTLPANSEDAGARGLFVRANDDGLQITSHGELVLDLSKRELAQLPADATIAISATE
1e92C           -------------LVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATADLSNVATAPAPVT
1civA           ----KSWKKIINVAVSGAA--GMISNHLLFKLASGEVFGPDQPISLKLLGSERSFAALEGVAMELEDSLY
3bywF           ---------QDLILGTLPA--NSEDAGARGLFVRANDDGLQITSHGELDLSKRELAQLPADATIAISATE
2bfmC           -------------LVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSALSATLNARRPNSAITVQADLSNV
1cg1A           ---------------------------YEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFVNYYKAEAV
1e7qA           ----------------------------------------------------------------------
2bfpD           ---------VPVALVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSAAENSAITVQADLSNVATAPVAPV
1e92D           ---------VPVALVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQA
3bywB           ---------QDLILGTLPA--NSEDAGARGLFVRANDDGLQITSHGELDLSKRELAQLPADATIAISATE
2bkaA           -------MQNKSVFILGAS--GETGRVLLKEILEQGLFSKVTLIGRRKLTF----------DEEAYKNVN
1d0iA           ---------------------------NAPIMILNGPNLNLLGQSDTLADVEALCVKAAAAHGG-TVDFR
3dooA           ----------------------------------------------------------------------
1a4iA           -------IAGRHAVVVG--RSKIVGAPMHDLLLWNNATVTTTAHLDEEVNKGDILVVATGQPEMVKGEWI
2bfoC           -------------LVTGAA--KRLGRSIAEGLHAEGYAVCLHYHRSAAEASAITVQADLSNVATAPVTLF
3e9nD           ----------------------------------------------------------------------
2eggA           ----------------------------------------------------------------------
3c0bC           ---------------------------TKITELHENGEFKVHHLYF--PDKLAEVLKTYSNDVSHALVTT
1d4fA           IKRATDVMIAGKVAVVAGYGD--VGKGCAQALRGFGARVIITEIEPINALQAAMEGYE-VTTMDEACKEG
2bf7C           ----------------------------------------------------------------------
3e9nE           ----------------------------------------------------------------------
3bywA           -VASVDKLRKDQDLILGTLPANSEDAGARGLFVRANDDGLQITSHGELDLSKRELAQLPADATIAISATE
2e6eB           --------------------------------------ILVTNDDGIYSPGLWALAEAASQ-FGEVFVAA
3e9nC           ----------------------------------------------------------------------
3c3xA           ----------SKILIFGGT--GYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLD--------EFQSLGAI
2ef0A           LKEVFGGLAGLEVAWVGDGNN--VLNSLLEVAPLAGLKVRVATPKGYEPDPGLLKRANAFFTHDPKEAAL
3e9nA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DLETIDSVFASLEQHWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFNRTMDISVFSLAAVAKRAEPIMND
1dohB           VVEDIVRMFEEAVKIFGKLDIVCSNSGVV----SFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLIG
2b35A           HLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
1dfiA           EDASIDTMFAELGKVWPKFDGFVHIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNP
3bmoB           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAEL-IGTNAIAPFLLTMSFAQRQ
3ch6E           DMTFAEQFVAQAGKLMGGLDMLILNHITNT----SLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLQS
2ae1A           SRSERQELMNTVANHFHGKLNILVNNAGIVIY---KEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLSE
3ek2A           DDAQIDALFASLKTHWDSLDGLVHIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPMLSD
1c14A           EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNP
2d1yA           DERERVRFVEEAAYALGRVDVLVNNAAIAAPGSA----LTVRLPEWRRVLEVNLTAPMHLSALAAREMRK
3d3wA           VDLGDWEATERALGSVGPVDLLVNNAAVA----LLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARIARG
2aqiA           HLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
3ek2B           DDAQIDALFASLKTHWDSLDGLVHIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPMLSD
2b35E           HLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
3ctmF           DPKSVEETISQQEKDFGTIDVFVANAGV-----------TWTQGPENKIISVDLNGVYYCSHNIGKIFGK
3d3eA           DMTFAEQFVAQAGKLMGGLDMLILNHITNTS----LNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLQS
3d5qC           DMTFAEQFVAQAGKLMGGLDMLILNHITNT----SLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKS
2b4qB           SEAGARRLAQALGELSARLDILVNNAGTSPVSG----WEKVMQLNVTSVFSCIQQLLPLLRRSASA-ENP
3bzuB           DMTFAEQFVAQAGKLMGGLDMLILNHITNT----SLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKS
1cwuA           LMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGSPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPPG
2b37C           HLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
3e03B           EEDQVRAAVAATVDTFGGIDILVNNASAIWLRGTLDTPKRFDLQQVNARGSFVCAQ----ACLPHLLQAP
3d5qD           DMTFAEQFVAQAGKLMGGLDMLILNHITNT----SLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ
3ch6B           DMTFAEQFVAQAGKLMGGLDMLILNHITNT----SLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLQS
1d7oA           SNWTVQEAAECVRQDFGSIDILVHSLANGPEVSKP--LLETSRKGYLAAISASSYSFVSLLSHFLPIMPG
2belC           DMTFAEQFVAQAGKLMGGLDMLILNHITNTS----LNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLQS
2cfcA           DEGDVNAAIAATMEQFGAIDVLVNNAGITGNSE-AGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMQG
2dknA           LDGLVCCAGVGVTAANSGLVVAVNYFGVSALL--DGLAEALSRGQQPAAVIVGSIAATQPGAAELPMVEA
2b36B           HLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
2d1yB           DERERVRFVEEAAYALGRVDVLVNNAAIAAPG----SALTVRLPEWRRVLEVNLTAPMHLSALAAREMVG
3dwfB           DMTFAEEFVAEAGNLMGGLDMLILNHVLYN----RLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQ
1a27A           DVRDSKSVAAARERTEGRVDVLVCNAGLG----LLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMRG
1a9zA           RNEALMTEILHDHAIDTVIHFAGLKAVGESVQKP----LEYYDNNVNGTLRLISAMRAANVKNFIFSSAA
3ctmH           DPKSVEETISQQEKDFGTIDVFVANAGVTWTQGPEIKI--------ISVDLNGVYYCSHNIGKIFKKNGK
3ek2C           DDAQIDALFASLKTHWDSLDGLVHSIGFAPRAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPMLSD
2bgkA           KDEDVRNLVDTTIAKHGKLDIMFGVGVLSTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKK
2aqhA           HLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
2ekpA           PKGLVKRALEAL----GGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWG
2aq8A           HLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
3czrA           DMTFAEQFVAQAGKLMGGLDMLILNHITNT----SLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLQS
3ek2D           DDAQIDALFASLKTHWDSLDGLVHIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPMLSD
2b35C           HLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
3ch6D           DMTFAEQFVAQAGKLMGGLDMLILNHITNT----SLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ
2b35F           HLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
2e6gK           QFGEVFVAAPDTITIAHPVRAYPHPSPPHFP----AYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNL
3c6cA           --------------------------------------------------------FQELGIKPELEVFS
3e9qA           TSENCQQLAQRIVVNYPRLDGVLHNAGLLG----DVCPSEQNPQVWQDVQINVNATFLTQALLPLLLKSD
2aqkA           HLASLAGRVTEAIGAGNKLDGVVHAIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
3diiA           DPLTLKKFVEYAMEKLQRIDVLVNNACGSKG-----ILSSLLYEEFDYILSVGLKAPYELSRLCRDELIK
2d1yC           DERERVRFVEEAAYALGRVDVLVNNAAIAAPG----SALTVRLPEWRRVLEVNLTAPMHLSALAARRKVG
3csdB           SVPEIEALVAAVVERYGPVDVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERG
2belD           DMTFAEQFVAQAGKLMGGLDMLILNHITNT----SLNLFHDDIHHVRKSMEVNFLSYVVLTVAAPMLKQS
2a4kB           DPKAVEAVFAEALEEFGRLHGVAH----------------FAGVAWEKVLRVNLTGSFLVARKAGEVLEE
2belB           DMTFAEQFVAQAGKLMGGLDMLILNH----ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLQS
2a4kA           DPKAVEAVFAEALEEFGRLHGVAHFAG--------VAHSALPLEAWEKVLRVNLTGSFLVARKAGEVLEE
2belA           DMTFAEQFVAQAGKLMGGLDMLILNHITNTS----LNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLQS
3edmB           NAAEVEAAISAAADKFGEIHGLVHVAGGLIA---RKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMKG
3ce6B           TATGNKDIIMLEHIKAMKDHAILGNIGHFD----NEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSILS
2b35D           HLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
2b35B           HLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
2b37B           HLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
2ag5A           KKKQIDQFAN----EVERLDVLFNVAGFVHHG----TVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLA
1dj2A           TPEMLREEVEAYKRYADRLEPYITDT---------VHFINDSISQKKKVLVEGGQATMLDIDFGTYPFSS
2b4qA           SEAGARRLAQALGELSARLDILVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLSASAENP
3c2qA           DAGNIKNAVESGVLKEGIYQCIKNNIPY-------VLAGSIRDDGPIPDVITDSVAQDKRTTVDKKVILS
2ag5B           KKKQIDQFA----NEVERLDVLFNVAGFVHH----GTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLA
3e03A           EEDQVRAAVAATVDTFGGIDILVNNASAIWLRGTLDTPKRFDLQQVNARGSFVCAQACLPHLL----QAP
3e03C           EEDQVRAAVAATVDTFGGIDILVNNASAIWLRGTLDTPKRFDLQQVNARGSFVCAQACLPHLL----QAP
2ag5C           KKKQIDQFAN----EVERLDVLFNVAGFVHHG----TVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLA
3d5qA           DMTFAEQFVAQAGKLMGGLDMLILNHITNTSL----NLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ
3ctmE           DPKSVEETISQQEKDFGTIDVFVANA---------GVTWTDNYDSWNKIISVDLNGVYYCSHNIGKIFKK
1ahhA           SEQELSALADFAISKLGKVDILVNNAGGGG-----PKPFDMPMADFRRAYELNVFSFFSQLVAPEMEKNG
2dknB           RCGGVLDGLVCCAGVNSGLVVAVNYFGVSALLD--GLAEALSRGQQPAAVIVGSIAATQPGAAELPMVEA
2e6hB           QFGEVFVAAPDHITIAHPVRAYPHPSPPHFP----AYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNL
3c2qB           DAGNIKNAVESGVLKEGIYQCIKNNIPYVLAGSIR-------DDGPIPDVITDSVAQDKRTTVDKKVILS
3ch6A           DMTFAEQFVAQAGKLMGGLDMLILNHITNTSL----NLFHDDIHHVRKSMEVNFLSYVVLTVAALPLKQS
2e6cC           QSAAGHAIT-----IAHPVRAYPHPSPLHA----PHFPAYRVRGTPADCVALLFGPVDLVLSGVNLGSNL
3dijA           DPLTLKKFVEYAMEKLQRIDVLVNNACGSKG-----ILSSLLYEEFDYILSVGLKAPYELSRLCRDELIK
3byzA           DMTFAEQFVAQAGKLMGGLDMLILNHITNTSLN----LFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ
1auvA           KVVRSLKPDFVLIRQHAFSARNGDYRSLVIGLQYAGIPSINSLHSVYNFCDKPWV--FAQVRLHKKLGTE
3d5qB           DMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDD----IHHVRKSMEVNFLSYVVLTVAALPMLKQ
3edmA           NAAEVEAAISAAADKFGEIHGLVHVAGGLIARK---TIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAK
1dohA           VVEDIVRMF----EEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEI
1dhrA           QADQVTAEVGKLLGDQKVDAILCVAGGWAGGNA----KSKSLFKNCDLMWKQSIWTSTISSHLATKHLKE
3cxtA           DEDGIQAMVAQIESEVGIIDILVNNAGIIRR----VPMIEMTAAQFRQVIDIDLNAPFIVAVIPSMIKKG
3bmeC           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKVETQVAELIGTNAIAPFLLTM---SFAQR
2eghA           DEASAKLLKTMLQQQGSRTEVLSGQQAACD----MAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILAN
1bmdA           PLLAGLEATDDPDVAFKDADYALLVGAAPRKAGME---RRDLLQVNGKIFTEQGRALAEVAKKDVKVLGN
3ctmG           DPKSVEETISQQEKDFGTIDVFVANAGV--------TWTVDNYDSWNKIISVDLNGVYYCSHNIGKIFKK
3deyX           DSKSVAAARERVTEG--RVDVLVCNAGLG----LLGPLEALGEDAVASVLDVNVVGTVRMLQAFDMKRRG
2aw5B           AHEHEEMKNLEAIVQEIKPT-ALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYTK
3e6vA           PVSFLLKELKGKIPDVPGFSWVTPCISLRDVNPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLGR
3ctmA           DPKSVEETISQQEKDFGTIDVFVANAGVTWT----QEIDVDNYDSWNKIISVDLNGVYYCSHNIGKIFKK
3cq0B           LSFDKKATVKKALHIIKLYKDAGVPKERVLIK---IASTWEGIQAARELEVKHGIHCNMTLLFSFTQACA
3d4nB           DMTFAEQFVAQAGKLMGGLDMLILNHITNTSL----NLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ
2cnbB           GDVRNEDFLNGVFTRHGPIDAVVHMCAFLA----VGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKISS
3bzuA           DMTFAEQFVAQAGKLMGGLDMLILNHITNTSL----NLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ
3ctmD           HSKAYKCNISDPKSVEETISQQEKDFGTIDVFVANAGVTWTQGPEIDKIISVDLNGVYYCSHNIGKIFKK
3d4nD           DMTFAEQFVAQAGKLMGGLDMLILNHITNT----SLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLQS
1c9yA           ENGTKLLLTNDPLEAAHGGNVLITDTWISM----GREEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCL
3d4nC           DMTFAEQFVAQAGKLMGGLDMLILNHITNTS----LNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ
3d3uA           IHTEMFTDGVMRMIRKGIINGKKKTLHPEKVVTSLIFGSKELYDFVNNNPVIECYPVDYINNPDVIGKND
2aw5C           AHEHEEMKNLEAIVQEIKPT-ALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYTK
2d1yD           DERERVRFVEEAAYALGRVDVLVNNAAIAAP----GSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRK
3d7lA           TVDITNIDSIKKYEQVGKVDAIVSATGSATF----SPLTELTPEKNAVTISSKLGGQINLVLLGIDSLND
2ae2A           DLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPKASE
3e9qB           LTCTSENCQQLAQRIVVNYPRLDGVL-HNAGLLGDVCPSEQNPQVWQDVQINVNATFLTQALLPLLLKSD
3cxrA           CDVTDEDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIK
1cydA           CVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGV
3bhmA           DLQSIRALRDFLRKEYGGLDVLVNNAGIAFK----VADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKP
3bzuD           DMTFAEQFVAQAGKLMGGLDMLILNHITNTS----LNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ
2ekqD           PKGLVKRALEAL----GGLHVLVHAAAVNVRK----PALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAE
1edoA           KEADVEAMMKTAIDAWGTIDVVVNNAGITRDT----LLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMKR
2ehdA           EEGDWARAVAAMEEAFGELSALVNNAGVGVM----KPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLR
2e6hD           GHAIT---------IAHPVRAYPHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGV-NLGSNL
2c07A           SKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQ-PISKRMINNR
3bzuC           MEDMTFAEQFVAQAGKLMGGLDMLILNHITNT--SLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ
3ce6D           TATGNKDIIMLEHIKAMKDHAILGNIGHFDNEID----MAGLERSGATRVNVKPQVDLWTFGDTGRSILS
1e3wA           KEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQ
3d7lD           -----------------------------------SPLTELTPEKNAVTISSKLGGQINLVLLGIDSLND
1e6wD           KEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGAGVMGQNEPDQGGQ
1ae1B           RTERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPL--LKASQ
3edmC           NAAEVEAAISAAADKFGEIHGLVHVA---GGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAK
3d3eB           DMTFAEQFVAQAGKLMGGLDMLILNHITNTSL----NLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ
3ctmB           HSKAYKCNISDPKSVEETISQQEKDFGTIDVFVANAGVTWTQGPEIDKIISVDLNGVYYCSHNIGKIFNG
3dwfA           DMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDN----VRKSMEVNFHSFVVLSVAAMPMLMQ
3dwfC           DMTFAEEFVAEAGNLMGGLDMLILNHVLYNR----LTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQ
1ae1A           RTERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQN-
3ctmC           DPKSVEETIS--QQEKDFGTIDVFVANAGVTWVDNYDSWNKIISVDLNGVYYCSHNIGKIFKK-----NG
3bmnB           VLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKS
2bfaB           LFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRGDREAMETATADLFGSNAIAAHRVAGTPAKHRGT
2bfoA           LFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRGDREAMETATADLFGSNAIAPYFLIKAFAKHRGT
3ce6A           TATGNKDIIMLEHIKAMKDHAILGNIGHFD----NEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSILS
2c7vD           NSNVLPASCEEIINSCFRAFGRCDVLVNNASLVQGDHNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKG
1e6wB           KEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFVMGQNEPDQGGQ
2c59B           LKVTEGVDHVFNLAADMGGMGFIQS----NHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFK
3d4nA           DMTFAEQFVAQAGKLMGGLDMLILNHITNTSL----NLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ
1b8pA           PLLAGMTAHADPMTAFKDADVALLVGARPRGPGM----ERKDLLEANAQIFTVQGKAIDAVASRNIKVGN
3bmiB           NSNVLPASCEEIINSCFRAFGRCDVLNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSS
2c7vA           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQ
3bmoD           NSNVLPASCEEIINSCFRAFGRCDVLVNNYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSNL
1a9yA           ----------------------------------------------------------------------
3bmfD           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTP-LVGKTVETQVAELIGTNAIAPFLLTMSFAQRQ
1bdbA           EDQKQAASRCVARFGKIDTLIPNAGIWDYSTALVDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVAS
3edmD           NAAEVEAAISAAADKFGEIHGLVHVAGGLIARK---TIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAK
3bmoA           NSNVLPASCEEIINSCFRAFGRCDVLAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTTS
2ehdB           EEGDWARAVAAMEEAFGELSALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPA--LLRRG
2cukA           LTPETHRLLNRERLFAMKRGAILLNTARGALVDTE----ALVEALRGHLFGAGLDVTDPEPLPPGHPLYA
2c59A           LKVTEGVDHVFNLAADMGGMGFIQSNHSVIMY----NNTMISFNMIEAARINGIKRFFYASSACIYPEFK
1e3sA           KEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQ
2dteA           NPDQVKASIDHIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRD-
1bhsA           TLQLDVRDSKSVAAARERVTEGRVDVLVCNAGGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKR
3bmkC           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQK
1e6wA           VQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQ
3bmeB           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQN-
3bmqC           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGGKTVETQVAELIGTNAIAPFLLTMSFAQS
3bmdB           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELI-GTNAIAPFLLTMSFAQRQ
3bmnD           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFSFAQRQKGSS
3bmnC           NSNVLPASCEEIINSCFRAFGRCDVLVNNYPTPLVGKTVETQVAELIGTNAIAPFLLTMSF--AQRQKSS
2bfaA           LFTRCAELVAACYTHWGRCDVLVNNASSRDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGT
3bmfA           DLTNSNVLPASCEEIINSCFRAFGRCDVLVNNAPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSN
1e6wC           KEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFVMGQNEPDQGGQ
1di7A           DEQAIIEQTLCELVDEMSCHLVLTTGGTGPARR------DVTPDATLAVADREMPGFGEQMRQISLHFVP
2c7vB           LTNSNVLPASCEEIINSCFRAFGRCDVLVNYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKT
2bfpB           DLSNVATAPAPVTLFHWGRCDVLVNNASSFYPTPLLGDREAMETATADLFGSNAIAAHRVAGTPAKHRGT
2dfdA           AVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVN
3bmeA           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQS
3bmqA           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGVETQVAELIGTNAIAPFLLTMSFAQRQKG
2bf7A           DLSNVATAPAPVTLFTRCRCDVLVNNASSFYPTPLLGDREAMETATADLFGSNAIAAHRVAGTPAKHRGT
3bmfB           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNL
2e6cD           HAITIAHPVR-AYPHPSPLHAPHFPAYR-------VRGTPADCVALGLHLFGPVDLVLSGVNLG---SNL
1e7wA           PVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLREAMETATADLFGSNAIAPYFLIKAFAHRVAG
2bd0A           DMADVRRLTTHIVERYGHIDCLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFAL--MERQH
2a92C           GSNSYDDLKG-----ADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTN
1di6A           EQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVT-------PDATLAVADREMPGFGEQMRQISLHFVP
3d7lF           --------------KKYEQVGKVDAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLND
2c7vC           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGGKTVETQVAELIGTNAAQRQKGTNPNCTS
3bmjD           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQS-
2cnbA           NEDFLNGVFTRHGPIDAVVHMCAFLAVGESV----RDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSA
2e6bC           AITIAH--PVRAYPHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVD----------LVLSGVNLGSNL
2e6bD           HAITIAHPVRAYPH-PSPLHAPHFPAYRVRGTPAD-------CVALGLHLFGPVDLVLSGVNLG---SNL
3bmoC           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTTQVAELIGTNAIAPFLLTMSFAQRQKS
3bmfC           SNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNL
1a4uA           VPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILD------FWDKRKGGP
3bmnA           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQ
2bfmB           DLSNVATAPVAPVTLFTRCAELVAACYTHWGRCDVLRNREAMETATADLFGSNAIAPYFLIKAFAKHRGT
2e6hC           HAITIAHPVR----AYPHPSPLHAPHFPAYR----VRGTPADCVALGLHLF---GPVDLVLSGVNLGSNL
1d4gA           TTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNEN----AVEKVNIKPQVDRYLLKNGRRIILL
1ek5A           EFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKNLVFSSSATV
1e7wB           LFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRGDREAMETATADLFGSNAIAPYFLIKAFAHRVAT
1e92A           ------------------------------------------GSNAIAPYFLIKAFAHRVAGTPAKHRGT
3d64A           IFVTATGNYHVINHDHMKAMRHNAIVCNIGHF----DSEIDVASTRQYQWENIKPQVDHIIFPDGKRVLA
3dfzA           LLNVFFIVVATNDQAVNKFVKQHIKNDQLVNNIQIPAQFSRGRLSLAISTDGASPLLTKRIKEDLSSNES
1c9kB           CWRHLDTLITADLAPDDAILLECITTMVTN-----LLFALGGENDPEQWDYAAMERAIDDEIQILIAARC
2bfaC           LFTRCAELVAACYTHWGRCDVLVNNASFYPTPLLRREAMETATADLFGSNAIAPYFAHRVAGTPAKHRGT
2e6eD           HPVRAYPHPPHFPAYRVRADCVALGLHLFGP----VDLVLSGVNLVAAAKQGYLFGLSAAAFSVPEVPDF
3e48A           NQESVEAFKGDTVVFIPSIIHPSFRIPEVE-----NLVYAAKQSGVAHIIFIGYYADQHNNPFHSPYFAS
2bf7B           DLSNVATAPSAPVTLFTRCAELVAACYTHWGRCDVLLLREAMETATADLFGSNAIAPYFLIKAFAHRVAG
1dj3A           SKGMLKEEVERYKKFAERLEPFIADT---------VHVLNESIRQKKKILVEGGQATMLDIDFGTYPFVT
3e8xA           ----------------------------------------------------------------------
2aw5A           AHEHEEMKNLEAIVQEIKPTALIGV-AAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSACYKITK
1bxkA           KVDICDRAELARVFTEHQPDCVMHLAAESH----VDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTED
1e92B           DLSNVATAPSAPVTLFTRCAELVAACYTHWGRCLRREAMETATADLFGSNAIAPYFAHRVAGTPAKHRGT
3dhnA           RHPEKIKIENEHLKVKKADVSSLDEVCEVCKGADAVISAFNPIYDETIKVYLTIIDGVKKAGVNRFLVGG
1cbuC           CWRHLDTLITA--DLAPDDAILLECITTMVTNLLFALGGENDPEQWDYAAMERAID-DEIQILIAACQRC
2bfaD           LFTRCAELVAACYTHWGRCDVLVNNASSRDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGT
2c5eB           VTEGVDHVFNLAADMG------GMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEKQ
1c9kA           AECWRHLDTLITADLAPDDAILLECITTMVTN----LLFALDPEQWDYAAMERAIDDEIQILIAAC-QRC
3d7lB           --------------------------------------TELTPEKNAVTISSKLGGQINLVLLGIDSLND
2c54B           LKVTEGVDHVFNLAADMGGMGFIQS----NHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFK
1c3vA           FTHPDVVMGNLEFLIDNGIHAVVGTTGFTA----ERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFQA
2bf7D           --------------VLVNNASSFYPTPLLRREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGT
1a7aB           TTTGCIDIILGRHFEQKDDAIVCNIGHFDVE----IDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLA
2dt8A           SPEDFARVYREALEEADHVLSLHISGKLSGT---VQSAELAAQEFPGRVTVVDTASLGVGVLRAKELLEE
1b3rA           TTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDV----KWLNENAVEKVNIKPQVDRYLLKNGHRIILL
2axqA           AISLDVTDDSALDKVLADNDVVISLIPYT----FHPNVVKSAIRTKTDVVTSSYISPALRELEPEIVK--
1bdmB           -------------------------------------------------------------------VGN
3dqpA           -------------------------------------------------------------------AEV
2a92A           GSNSYDDLK-----GADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTN
1cg3A           KVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYP-------------YVTSS
2e37E           SYGDLEGARAAQRPGETRLQLLDRAQVFAQVVPRV---LEAAPEAV-LLVATNPVDVTQVAYRLSGLPVG
3bywC           DETTAGIEGDTVERDVRPIIGIYT----------------------------------------------
3bywD           DETTAG--IEGDDSTTETVERDVRPIIYTELE--------------------------------------
2c20A           GDLRDKAFLRDVFTQENIEAVMHFAADSLVGVSMEKPLQYYNNNVYGALCLLEVMDEFKVDKFIFSSTAA
3dtdB           DQNRVVVAMSVVLNADGVVSGNLTVPFGILVSKPVRLQKAVIETGIRTCVPAGCIVPIVFDKNYVAALAG
3bywH           DETTAG--IEGDDSTTETVERDVRPIIYTELE--------------------------------------
1e92C           LFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNDREAMETATADLFGSNAIAPYRVAGTPAKHRGT
1civA           PLLRQVSIGIDPYEIFQDAEWALLIG---AKPRGPGMERADLLDINGQIFAEQGKALNAVASPNVKVMVV
3bywF           DETTAGIEGDDSTTETVERDVRPIIGIYTE----------------------------------------
2bfmC           ATAAPVTLFTRCAELVAACYTSFYPTPLLRREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGT
1cg1A           DYQKVLDDTMAVADILTSMVVDVSDLL------------DQARQRGDFVMFEGAQGTLLDIDHGTYPYSS
1e7qA           -----------------------------------DFIYQNMMIESNIIHAAHQNDVNKLLFLGASCIKL
2bfpD           TLFTRCAELVAACYTHWGRCDVLVNSSFYPTPLLRREAMETATADLFGSNAIAPYFAHRVAGTPAKHRGT
1e92D           DLSNVATAPAPVTLFTRCAELVAACYSFYPTPLLRREAMETATADLFGSNAIAPYFLIKAFAHRAKHRGT
3bywB           DETTAGIEGDDSTTETVERDVRPIIGIYTE---LESNAADLLNAGLNAHVEISRFT--------------
2bkaA           QEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSA---------------ELAKA
1d0iA           QSNHEGELVDWIHEARLNHCGIVINPAAYSHT-SVAILDALNTCDGLPVVEVHISNIHQREPF-------
3dooA           -------------SLNINKINLSHAESHLDEFDIIINTTPVISLNRLASHTLVSDIVYNPYKTPILIEQR
1a4iA           KPGAIVIDCGINYKVVGDVAYDEAKERASF----ITPVPGGVGPMTVAMLMQSTVE--------------
2bfoC           TRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRDREAMETATADLFGSNAIAPYFAHRVAGTPAKHRGT
3e9nD           ----------------------------------------------------------------------
2eggA           -----------------------------------PRVEVQPLSLERLRPGVIVSDIIYNPLETKWLKAR
3c0bC           AEEGVDNILNAAESAFGSNISVFDSNGNFISLESAKTNNKVSASNWCGTAKWV------------SKNIE
1d4fA           NIFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGHRIILA
2bf7C           ----------------------------------------------------------------------
3e9nE           ----------------------------------------------------------------------
3bywA           DETTAG--IEGDDSTTETVERDVRPII-------------------------------------------
2e6eB           PDTTIAHPVRAYPHPSPPHFPAYRVRGTPA----DCVALGLHLFGPVDLVLSGVNLAAAKQGYLFGLS--
3e9nC           ----------------------------------------------------------------------
3c3xA           IVKGELDEHEKLVELMKKVDVVISALAVPQYLDQFKILEAIKVAGNIKRFLPSDFG--------------
2ef0A           GAHALYTDVWTEKRLRDFQGFQVNGELLKLLRPEGHYGEETTEEAVHGPRSRVFDQAENRLHTAKAVL--
3e9nA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GGSIITLTYYGAEKVMPNYNVMGVAKAALEASVRYLAVDLGNRGIRVNAVSAGPIKTLAASGIGDFRYIL
1dohB           GRLILMGSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCREYIPN
2b35A           PGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT----GAQIQLLEE
1dfiA           GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT----------LML
3bmoB           NLSIVNLCDAMV-DQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
3ch6E           NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLIDTETAMKAAPKEECA
2ae1A           RGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIAT----QDPEQKENL
3ek2A           DASLLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPISG-----IKSFGKIL
1c14A           GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKML
2d1yA           VGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIARRDWE
3d3wA           VPGAIVNVSSQSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKA
2aqiA           PGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGQLLEE
3ek2B           DASLLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKF---------GKIL
2b35E           PGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT---AGAQIQLLEE
3ctmF           GSLIITSSISGKIVNIPQLQAPYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDT--DITDFASKDMK
3d3eA           NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSRVNVSITLCVLGLIDTTAMKAVSGIEECA
3d5qC           NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSRVNVSITLCVLGLIDTETAMKAVQAAPKE
2b4qB           ARVINIGSVAGISAMGEQAYAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRHIANDPQAL
3bzuB           NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDTETAMKAVSGEECA
1cwuA           GASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEARKQNIRVNTISAGPLGSRAAKAIGFIDTMI
2b37C           PGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTGALGEEAGQLLEE
3e03B           NPHILTLAPPPSLNPAWWGAHTGYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIATD-----------
3d5qD           NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEVSRVNVSITLCVLGLIDTTAMKAVSMQAAPK
3ch6B           NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSRVNVSITLCVLGLIDTETAMKAVSKEECA
1d7oA           GASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVTISAGPLGSRAAKAIGFIDTMI
2belC           NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSRVNVSITLCVLGLIDTETAMKAVSGMQAA
2cfcA           AGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLDQPELR
2dknA           MAGDEARAIELAEQQGQTHLAYAGSKYAVTCLARRNVVDWAGRGVRLNVVAPGAVEPLLQASKADPRYGE
2b36B           PGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTALGEEAGAQILEE
2d1yB           GGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEA---VLEAIRTR
3dwfB           SQGSAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVSITLCILGLIDTETAIKATSGIECA
1a27A           SGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTLDRTDIHTFHRFY
1a9zA           YGDNPKIPYVESFPTGTPQSPFGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIP
3ctmH           GSLIITSSISGKIVNIPQLQAPYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDT--DITDFASKDMK
3ek2C           DASLLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKT-------SFGKIL
2bgkA           GSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFSSRVEE
2aqhA           PGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGQLLEE
2ekpA           RVLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELY
2aq8A           PGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGE
3czrA           NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTTAMKAVSGVHMQA
3ek2D           DASLLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKS--------FGKIL
2b35C           PGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLV---------AAGPIRTLLEE
3ch6D           SGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNITLCVLGLIDTETAMKAVSGIECA
2b35F           PGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTQI------QLLEE
2e6gK           GHEIWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIP
3c6cA           PGDILFLIEEGLIDGVPLFQVLGVLWGAPASTETIYQRNLIPANAQWAAFGIGRDPAQAALLGGNVRVGL
3e9qA           AGSLVFTSSSVGRQGRANWGAYA---ASKFATEGQVLADEYQQRLRVNCINPGGTRTARASAFPT-----
2aqkA           PGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGQLLEE
3diiA           NKRIINIASTRAFQSEPDSEAYASAKGGIVALTHALAMS-LGPDVLVNCIAPGWI---------NVTEFT
2d1yC           GGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIALERTR
3csdB           TGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETMAASVREHTEEAF
2belD           NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTIVHMQAAPKEECA
2a4kB           GGSLVLTGKLG---------VVGLART--------LALELARKGVRVNVLLPGLIQAW------------
2belB           NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNITLCVLGLIDTETAMKAVSKEECA
2a4kA           GGSLVLTGS-VAGLGAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGL--PPWAW
2belA           NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVTLCVLGLIDT-------------
3edmB           GAIVTFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEV-------------------GPKIRVNAVCP
3ce6B           EGRLLNLGANQTIAQIELWTKNDEYDNEVYRLPKHLDEKVARIHVEALGGHLTKLTKEQAEYLG------
2b35D           PGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT---------LAME
2b35B           PGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGP-----------IRTEE
2b37B           PGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEG-----------
2ag5A           QKIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAEEAR
1dj2A           SPSAGGICTGLGIAPSVVGDLIGVVKAYTTRVGSGPFPGTGGDLLRLAGQEFGTTTGRPRRCGWLDIVAL
2b4qA           ARVINIGSVAGISAMGEQAYAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRHIANDPQAL
3c2qA           TLLHS----------VATGNLPSYIKTVCVDIQPSTVTKLDRGTSQAIGVVTDVG---------------
2ag5B           GNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAEEAR
3e03A           NPHILTLAPPPSLNPAWWGAHTGYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIA-------------
3e03C           NPHILTLAPPPSLNPAWWGAHTGYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIAT------------
2ag5C           QNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNP
3d5qA           SNSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVMQAAPK
3ctmE           NGKGSLIITSSISGKIQLQAPYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDF---ASKDMK
1ahhA           GGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQ
2dknB           MAGDEARAIELAEQQGQTHLAYAGSKYAVTCLARRNVVDWAGRGVRLNVVAPGVAPL-------------
2e6hB           GHEIWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIP
3c2qB           TLLHS----------VATGNLPSYIKTVCVDIQPSTVTKLDRGTSQAIGVVTDVG---------------
3ch6A           NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIECA
2e6cC           GHEIWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIP
3dijA           NGRIINIASTRAFQSEPDSEAYASAKGGIVALTHAL-AMSLGPDVLVNCIAPGWINV----------TFT
3byzA           SNGSIVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHM
1auvA           EFPLINQTFYPNHKELSSTTYPVVVKG-------------------------------------------
3d5qB           SNSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHM
3edmA           GGAITFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVG-PKIRVNAVCPGMIST-------------
1dohA           GRLILMGSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCREYVDE
1dhrA           GGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKGMPSGAAAIAVLPVTLDT----------PMN
3cxtA           HGKIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQ------THPFD
3bmeC           QNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLL-----------PD
2eghA           KESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGFRETPL
1bmdA           PANTNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHS--STMFPDLFHAE
3ctmG           NGKGSLIITSSISGKIQLQAPYNTAKAACTHLAKS-LAIEWAPFARVNTISPGYIDT--DITDFASKDMK
3deyX           SGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTGSPEEVLDRTDIH
2aw5B           GRAIFASGSPFDPVTLPNGQTLYPGQSYVFPGVALGVVACGLRQITDNIFLTTAE---VIAQQVSDKHLE
3e6vA           KKRPIHLSFPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKT-------------
3ctmA           NGKGSLIITSSISGKIVQLQAPYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFA--SKDMK
3cq0B           EANVTLISPFVGRIMDFYKAYTAETDPGVLSVKKIYS-YYKRHGYATEVMAASFRNLDELKALAGIDNMT
3d4nB           SNSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHM
2cnbB           SAAIFGNPTAEPIDINAKKSPESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIGSTHLI
3bzuA           SNGSIVVVSSLAGKVAPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHM
3ctmD           SLIITSSISGKIVNIPQLQAPYNTAKAACTHLAKSLAIEW-APFARVNTISPGYIDT--DITDFASKDMK
3d4nD           NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTEAVSGIHMQAAPK
1c9yA           PRKPEEVDD--EVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKP--------------------
3d4nC           SNGSIVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTTAMKAVSGIMQAA
3d3uA           RMVSINSCLEMDLMGQAGQVDFLRGAKRSKGGISIMAFPSTAKKGTESRIVPILKTG-------RNEVDY
2aw5C           GRAIFASGSPFDPVTLPNGQTVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIA
2d1yD           VGGGAIVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEA---VLEAIATR
3d7lA           KGSFTLTTGI-----EDPIVQGASAAANGAVTAFAKSAAIEPRGIRINTVSPNVLEE-------------
2ae2A           RGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIEQKENL
3e9qB           AGSLVFTSSSVGRQGRANWGAYAASKFA---TEGQVLADEYQQRLRVNCINPGGTRTAR-----------
3cxrA           KGKIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRELHPFD
1cydA           PGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFA
3bhmA           QGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGVRTDMAGPKATKS
3bzuD           SNGSIVVVSSLAGKVYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHM
2ekqD           AGWFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVET----------ELY
1edoA           KGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDME--
2ehdA           RGGIVNVGSLAGKNPFKGGAAYNASKFGLLGLAGAAMLDLREANVRVVNVLPGLKPEVAQAVLFALEMPG
2e6hD           GHEIWHSGTVAAAKQGYLFGLSAAAFSVPLGEVPDFAGTLETVNVNLPLRPKGFLWTRQSVRAYEGVVIP
2c07A           YGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISS-------ISEQIK
3bzuC           SNSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVMQAAPK
3ce6D           EGRLLNLGNATGHPSFVMSNSLWTKNDEYDNEVYRLPKHLDEKVARIHVEALGGHLT-------------
1e3wA           NEPDINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFAT-----PLLTTVRN
3d7lD           KGSFTLTTGI-----EDPIVQGASAAANGAVTAFAKSAAIEPRGIRINTVSPNVLEE-------------
1e6wD           RGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTL-PDKVRN
1ae1B           NGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAIKKNPHQ
3edmC           GGIVTFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPKIRVNAVCPGSSEDVAGL----------
3d3eB           SNGSIVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAAPKEECA
3ctmB           KGSLIITSSISGKIVNIPQLQANTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASKDMKA--
3dwfA           SQSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFNKVNVSITLCILGLIDT-------------
3dwfC           SQSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFNKVNVSITLCILGLIDT-------------
1ae1A           -GNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILQ---------KEEI
3ctmC           KGSLIITSSISGKIQLQAPYNTAKAACTHLAKSLA---IEWAPFARVNTISPGYIDT--DITDFASKDMK
3bmnB           NLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
2bfaB           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHR
2bfoA           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHR
3ce6A           EGRLLNLGANQTIAQIELWTKNDEYDNEVYRLPKHLDEK----VARIHVEALGGHLTKLTKEQ-------
2c7vD           SSNLSIVNLCDAMVDQPMAFSLNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
1e6wB           RGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFAT---------PLLT
2c59B           QLTTNVSLKESDAWPAEPQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAF
3d4nA           SNGSIVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSIVHMQ
1b8pA           PANTNAYIAMKSAPSLPAKNFTAMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHS-------------
3bmiB           NLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
2c7vA           KGSSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
3bmoD           SIVNLCDAMVD--QPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
1a9yA           ---------------GTPQSPFGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIP
3bmfD           SNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
1bdbA           RGNVIFTISNAGFYPNGGGPLYTAAKHAIVGLVRELAFELAPY-VRVNGVGSGGINSDLRGPSSLGPLAD
3edmD           GAIVTFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPKIRVNAVCPGSS----------------
3bmoA           SNLSIVNLCDAMVDQCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
2ehdB           GGTIVNVGSLAGKNPFKGGAAYNASKFGLLGLAGAAMLDLREANVRVVNVLPGSVKL-------KPEDVA
2cukA           LPNAVI--------TPHIGSAGRTTRERMAEVAVENLLAVLEGREPPNPV--------------------
2c59A           QLETTNVSLKESDWPAEPQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFG-------------
1e3sA           RGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFAT-------------
2dteA           -PSIVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYAPL-LRCNAVCPATIDTPLVRKAAELEVGS
1bhsA           RGSVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTFMEKVLGSPEEVL
3bmkC           NLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
1e6wA           RGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFAT-----PLLTKVRN
3bmeB           -LSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
3bmqC           NLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
3bmdB           NLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAM----GEEEKD
3bmnD           NLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
3bmnC           NLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
2bfaA           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHR
3bmfA           LSIVNLCDAMVD-QPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAM----GEEEKD
1e6wC           RGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFAT--------PLLTN
1di7A           VGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLEGPYVET-------------
2c7vB           SSNLSIVNLCDAMVDQPMFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
2bfpB           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHR
2dfdA           STIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPK
3bmeA           NLSIVNLCDAMVDQPMAFSLYNM-GKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
3bmqA           SSNLSIVNLCDAMVDQPMAFSLNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
2bf7A           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHR
3bmfB           SIVNL---CDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
2e6cD           GHEIWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIP
1e7wA           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHR
2bd0A           SGHIFFITSVAATKAFRHSSIYCMSKFGQRGLVETMRLYARKCNVRITDVQPGA-----------VYTPM
2a92C           PVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRYITV--
1di6A           TAILSR-QVGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLEGPYV-------
3d7lF           KGSFTLTTG-----IEDPIVQGASAAANGAVTAFAKSAAIEPRGIRINTVSPNVLEE-------------
2c7vC           SNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
3bmjD           -NLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
2cnbA           AINPTNAEPIDINAKKSPESPYGESKLIAERMIRDCAEAYGIKGICLR----------------------
2e6bC           GHEIWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIP
2e6bD           GHEIWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIP
3bmoC           SNSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
3bmfC           SIVNLCDAMV---DQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLG--------EEEKD
1a4uA           GGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVE
3bmnA           SSNLSIVNLCDAMVDQPMAFSLYNMKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWR
2bfmB           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHR
2e6hC           GHEIWHSGTVAAAKQGYLFGLSAAAFSVPLNGEPDFALETLLRNVNLPLRPKGFLWTRQSVRAYEGVVIP
1d4gA           AGRLVNLGCAMGHPSFVMSNSFTNQVDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQ-------
1ek5A           YGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIP
1e7wB           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVL---------VDWE
1e92A           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDM---PPAVWE
3d64A           EGRLVNLGSNSFTNQTLAQIELFTRGGEYANKVYVLPKHLDEKVARLHLARIGAQLSELSDDQAAYIGVS
3dfzA           YTQYTQFLYECRVLIHRLNVSKSRKHELLTEIIDQYRLSLVKQREFLQQIE-------------------
1c9kB           PAKVVLVTNEVGMGIVPENRLARHFRDIAGR----VNQRLAAAADEVWLVVSGIGVKI------------
2bfaC           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVL-------------
2e6eD           AGRTLETLLRLERPFLVNVNLPLRPRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKE-------------
3e48A           RLLSTSGIDYTYVRAYDPLKPYLPELNHKLIYPAGDGRINYITRNDIARGVIAIIKNPDTWGKRYLLSGY
2bf7B           TPAKHRMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDM---PPAVWE
1dj3A           SPSAGGICTGLGIAPRVIGDLIGVVKAYTTRVGSGPFPTELLGEEGAGMEFGTTTGRPRRCGWLDIVALK
3e8xA           ---------------------------------------------DYTIVRPGPLSN------EESTGKV
2aw5A           GRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPG-------VALGVVACGLRQITDNIFLTTAEVIAQQ
1bxkA           KKS-------------------------------------------------------------------
1e92B           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHR
3dhnA           AGSLFIAPGLRLDSGEVPENILPGVKALGEFYLNFLK----EKEIDWVFFSPAADRP---GVRTGRYRLG
1cbuC           PAKVVLVTNEVGMGIVPENR----LARHFRDIAGRVNQRLAAAADEVWLVVSG-----------------
2bfaD           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVL-------------
2c5eB           LETTNVSLKESDAWPAEPQDAYGLEKLATEELCKHYNKD---FGIECRIGRFHNIYGPFGTWKGGREAAP
1c9kA           PAKVVLVTNEVGMGIVPENRLARHFRDIAGR----VNQRLAAAADEVWLVVSGIGVKI------------
3d7lB           KGSFTLTTG-----IEDPIVQGASAAANGAVTAFAKSAAIEPRGIRINTVSPNVLEE-------------
2c54B           LETTNVSLKESDAWPAEPQDAYGLERLATEELCKHYNKDFGIECRIGRFH--------------------
1c3vA           ARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAG
2bf7D           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVL-------------
1a7aB           EPSFVSNSFTNQVAQIELWTHPDKYPVGVHFLPKKLDEA----VAEAHLGKLNVKLT-------------
2dt8A           GQSL------------------------------------------------------------------
1b3rA           AEGLVNLGCAMGHPSFVMSNSFTNQVMKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQ-------
2axqA           -AGITVMNEIGLDPGIDHLYAVKTIDEVHRAGGKLKSFLSYCGGLPAPEDSDNPLGYKFSWSSRGVL---
1bdmB           PANTNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHS-----SIMFPDLF
3dqpA           KRFILLSTIFSLQPEKWIGAGFDALKDYYIAKHFADLYLTKETNLDYTIIQPGALTE---------EEAT
2a92A           PVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGN-------------
1cg3A           NTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGN----------------
2e37E           SGTILDTARFRALLAEYLRVAPQSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAES----------PED
3bywC           ----------------------------------------------------------------------
3bywD           ----------------------------------------------------------------------
2c20A           TYGEVDVDLITEETMTNPTNTYGETKLAIEKMLHWYSQA---SNLRYKIFRYFNVAGTPNGIIGEDHRPE
3dtdB           KHLKLAMTIAAP--GEPPL---NDLFVQLNGFSNALNRLIALQK--------------------------
3bywH           ----------------------------------------------------------------------
1e92C           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGP------------GLSVLV
1civA           GCNTNALICLKNAPNIPPKNFHALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHS-------------
3bywF           ----------------------------------------------------------------------
2bfmC           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGP------------GLSVLV
1cg1A           NTTAGGVATGSGLGPRYVDYVLGILKAYSTRGAGPFPTELFD----------------------------
1e7qA           AKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQ---YGRDYRSVMPTNLYG-------------
2bfpD           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGP------------GLSVLV
1e92D           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGP------------GLSVLV
3bywB           ----------------------------------------------------------------------
2bkaA           GGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSL
1d0iA           RHHSYVSQRADGVVAGCGVQGYVFGVERIAA---------------------------------------
3dooA           GNPIYNGLDMFVHQGAESFKIWTNLEPDIKAMKNIVIQKLK-----------------------------
1a4iA           ----------------------------------------------------------------------
2bfoC           NYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS-----------VLVD
3e9nD           ------------------------------GLADAFRKEEANNGIRVSTVSPGIEPKEIANAIR------
2eggA           GARVQNGVGMLVYQGALAFEKWTGQWPDVNRMKQLVIEALR-----------------------------
3c0bC           ENCILVDGSTTTDIIPIVEGKVVAEKTDLER----LNHELLYVGTLRTPISHLGNTISFKGVDTNVSSEY
1d4fA           EGRLVNLGCAMGHPSFVMSNSFTNQVMAYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQ-------
2bf7C           ----INMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGP------------GLSVLV
3e9nE           --------------------------------ADAFRKEEANNGIRVSTVSPGIEPKEIANAIR------
3bywA           ----------------------------------------------------------------------
2e6eB           AAAFSVPLEVPD--------FAGLRPWLLRTLETLLRLERPFVNVNLPLRPKGFLWTRQSVRAYEGVVIP
3e9nC           --------------------------------ADAFRKEEANNGIRVSTVSPGPEPKEIANAI-------
3c3xA           -------VEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFA----SYFINYLLRPYDPKDEI
2ef0A           ----------------------------------------------------------------------
3e9nA           ------------------------------GLADAFRKEEANNGIRVSTVSPGPTRP-------------


                         .         .         .         +         .         .         .:280
query           KWNEYNAPLKRTVTIEEVGKSALYLLSDLSTAVTGEIHHVDSGYHTIGMKAVDAPDISVVKD
1dohB           GENLSNEPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGAC-----------------
2b35A           GWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
1dfiA           AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAM-------------
3bmoB           RK---VPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
3ch6E           LEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNM------------------
2ae1A           NKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLM-----------------
3ek2A           DFVESNSPLKRNVTIEQVGNAGAFLLSDLASGVTAEVMHVDSGFNAVVG-------------
1c14A           AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAM-------------
2d1yA           DLH----ALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMT-----------------
3d3wA           KTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGFW-----------------
2aqiA           GWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
3ek2B           DFVESNSPLKRNVTIEQVGNAGAFLLSDLASGVTAEVMHVDSGFNAVVG-------------
2b35E           GWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
3ctmF           AKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGYT-----------------
3d3eA           LEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST----------------------
3d5qC           ECALEIIKLRQEEVYYDSSLWTTLLIRNPSRKILEFLY------------------------
2b4qB           EADSASIPMGRWGRPEEMAALAISLAGTAGAYMTGNVIPIDGGFH-----------------
3bzuB           LEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST----------------------
1cwuA           EYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGV-ALDSPV------
2b37C           GWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
3e03B           -AINLPGVDAAACRRPEIADAAHAVLTREAAGFHGQFLIDDEVLAQAGITDLSGYAV-----
3d5qD           EECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKI-------------------------
3ch6B           LEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNM------------------
1d7oA           EYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGV-ALDSPV------
2belC           PKEECALIKGGALRQEEVYYDSSLWTTLLI--------------------------------
2cfcA           DQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGAYTAI---------------
2dknA           STRRFVAPLGRGSEPREVAEAIAFLLGPQASFIHGSVLFVDGGM-DALMRAKT---------
2b36B           GWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
2d1yB           RDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTASFM-------------
3dwfB           LEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEELSAAEYNWNVLSNEK-----------
1a27A           QYLAHSKFREAAQNPEEVAEVFLTALRAPK--PTLRYFTTERFLPLLRMRLDDPSGSNYV--
1a9zA           NNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHV-----------------------
3ctmH           AKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGYT-----------------
3ek2C           DFVESNSPLKRNVTIEQVGNAGAFLLSDLASGVTAEVMHVDSGFNAVVG-------------
2bgkA           LAHQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTRTNPAFPTA--------
2aqhA           GWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
2ekpA           EPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFL-----------------
2aq8A           EAGAQIQLGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
3czrA           APKEECAALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTS---------------------
3ek2D           DFVESNSPLKRNVTIEQVGNAGAFLLSDLASGVTAEVMHVDSGFNAVVG-------------
2b35C           GWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
3ch6D           LEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYST----------------------
2b35F           GWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
2e6gK           GEDPMGRPFYWFAPRLKEAEEGTDRWAVAQGFVSATPLRLDLTDETR---------------
3c6cA           EDNLYLSRGVFATNGQLVE-RARTVIEHLGSVATPDEARDIGL-------------------
3e9qA           ------EDPQKLKTPADI--PLYLWLGDDSRRKTGTFDAQPGRKPGIS--------------
2aqkA           GWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
3diiA           QEDCAAIPAGKVGTPKDISNMVLFLCQQ--DFITGETIIVDGGMSKRMIYHGDWN-------
2d1yC           RDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMT-----------------
3csdB           DRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLG-----------------
2belD           LEIIKGGALRQEEVYYDSSLWTTLLIRNPC--------------------------------
2a4kB           EQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSIV---------------
2belB           LEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKI-----------------------------
2a4kA           EQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRS-----------------
2belA           --------------------------------------------------------------
3edmB           GMIST----TREGSSEDVAGLVAFLASDDAAYVTGACYDINGGVL-----------------
3ce6B           ------VDVEGPYKPDHY--------------------------------------------
2b35D           GWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
2b35B           GWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
2b37B           -WDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
2ag5A           NDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWS-----------------
1dj2A           KFSCQINKLDVLSDLNEIQLGVAYKRSDGTPVKS----------------------------
2b4qA           EADSASIPMGRWGRPEEMAALAISLAGTAGAYMTGNVIPIDGGFH-----------------
3c2qA           --------------------------------------------------------------
2ag5B           NDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWS-----------------
3e03A           -----TGVDAAACRRPEIADAAHAVLTREAAGFHGQFLIDDEVLAQAGITDLSGYAV-----
3e03C           DAINLPGVDAAACRRPEIADAAHAVLTREAAGFHGQFLIDDEVLAQAGITDLSGYAV-----
2ag5C           EEARNRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWS-----------------
3d5qA           EECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTS-----------------
3ctmE           AKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGY------------------
1ahhA           KMLQHT-PIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGG------------------
2dknB           ---------GRGSEPREVAEAIAFLLGPQASFIHGSVLFVDGGM-DALMRAKT---------
2e6hB           GEDPMGRFYWFAPRPLKEAEEGTDRWAVAQGFVSATPLRLDLTDE-----------------
3c2qB           --------------------------------------------------------------
3ch6A           LEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNM------------------
2e6cC           GEDPMGRPFAPRPLKEAEEGTDRWAVA--QGFVSATPLRLDLTDETR---------------
3dijA           QEDCAAIPAGKVGTPKDISNMVLFLCQQ--DFITGETIIVDGGMSKRMIYHGDWN-------
3byzA           QEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFL-------------------------
1auvA           --------------------------------------------------------------
3d5qB           QAAPKEEALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST----------------------
3edmA           ----------REGSSEDVAGLVAFLASDDAAYVTGACYDINGGVL-----------------
1dohA           YAAVQWSPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGAC-----------------
1dhrA           RKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTT-------------------
3cxtA           QFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGIL-----------------
3bmeC           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
2eghA           RDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEAR---------------------
1bmdA           VDGR---PALELVDMEWYEKVFIPTVAQRGAAI-----------------------------
3ctmG           AKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGY------------------
3deyX           TFHRFYQYLAHSKQV-----------------------------------------------
2aw5B           EGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVY---------------------------
3e6vA           --------------------------------------------------------------
3ctmA           AKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGY------------------
3cq0B           LPLNPIENKLNSESAKEEGVEKVSFINDEPHFRYVLNEDQMATEKLSDGIRKFSADIEALYK
3d4nB           QAAPKEEALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST----------------------
2cnbB           PIILGRVMSDIADKRMPIFGTDYPTPDGTCVRDYVHVCDLASAHILALDY------------
3bzuA           QAAPKEECLRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYN-------------------
3ctmD           AKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGYT-----------------
3d4nD           EECALEIIKGGALRQEEVYYDTTLLIRNPSRKILEFL-------------------------
1c9yA           --------------------------------------------------------------
3d4nC           PKEECALALRQEEVYYDSSLWTTLLIRNPSRKILEFLY------------------------
3d3uA           VVTEYGVARLRGATLRQRAEALTAIAHPDFRPLEEEI-------------------------
2aw5C           EKIVKDAQEKTATVYPEPQNKEAFVRSQMYSTDYDQI-------------------------
2d1yD           RDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMT-----------------
3d7lA           -SWDKLEPFFEGFLPVPAAKVARAFEKSVFGAQTGESYQV----------------------
2ae2A           NKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLM-----------------
3e9qB           ASAFPTEDPQKLKTPADIPL--YLWLGDDSRRKTGTFDAQPGRKPGI---------------
3cxrA           QFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGK------------
1cydA           RKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYL-----------------
3bhmA           PEEGAETPVYLALLPPDAEGPHGQFVSE----------------------------------
3bzuD           QAAPKEEALRQEEVYYDSSLWTTLLIRNPSRKILEFL-------------------------
2ekqD           EPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFL-----------------
1edoA           KKILGTIPLGRTGQPENVAGLVEFLLSPAASYITGQAFTIDGGIA-----------------
2ehdA           HAMVSEIELR----------------------------------------------------
2e6hD           GEDPMGRWFAPRPLKEAEEGTDRWAVAQ--GFVSATPLRLDLTDE-----------------
2c07A           KNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGL------------------
3bzuC           EECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEF----------------------
3ce6D           --------------------------------------------------------------
1e3wA           FLASQVPFPSRLGDPAEYAHLVQMVIEN--PFLNGEVIRLDGAIR-----------------
3d7lD           -SWDKLEPFFEGFLPVPAAKVARAFEKSVFGAQTGESYQV----------------------
1e6wD           FLASQVPFPSRLGDPAEYAHLVQMVIEN--PFLNGEVIRLDGAIR-----------------
1ae1B           KEEIVKTPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFTANG--------------
3edmC           ---------------------VAFLASDDAAYVTGACYDIN---------------------
3d3eB           LEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLY------------------------
3ctmB           -KWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGYT-----------------
3dwfA           --------------------------------------------------------------
3dwfC           --------------------------------------------------------------
1ae1A           DNFIVKTPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFT-----------------
3ctmC           AKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGY------------------
3bmnB           RKVPL---GRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
2bfaB           SKVPL---YQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
2bfoA           SKVPL---YQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
3ce6A           -AEYLGVDVEGPYKPDHY--------------------------------------------
2c7vD           RKVPLG---RREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
1e6wB           FLASQVPFPSRLGDPAEYAHLVQMVIEN--PFLNGEVIRLDGAIR-----------------
2c59B           CRKAQTSTDRFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGS-------------
3d4nA           AAPKEECIKGGALRQEEVYYDTTLLIRNPSRKILEFL-------------------------
1b8pA           --------------------------------------------------------------
3bmiB           RKVPL---GRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
2c7vA           RKVPLG---RREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
3bmoD           RKVPL---GRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
1a9yA           NNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADG-----------------
3bmfD           RKVPL---GRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
1bdbA           MLKSVL-PIGRMPEVEEYTGAYVFFATGDAAPATGALLNYDGGLGVRGFSGAGGNDL-----
3edmD           ---------------EDVAGLVAFLASDDAAYVTGACYDIN---------------------
3bmoA           RKVPLG---RREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
2ehdB           QAVLFALEMPGHAMVSEI--------------------------------------------
2cukA           --------------------------------------------------------------
2c59A           --------------------------------------------------------------
1e3sA           --PSQVPFPSRLGDPAEYAHLVQMVIEN--PFLNGEVIRLDGAIR-----------------
2dteA           DPMRIEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGGLSIRAP--ISTPE------
1bhsA           DRTDIHTFREAAQNPEEVAEVFLTALRAPKP--TLRYFTTERFLPLLRMRLDDPSGSNYV--
3bmkC           RKVPL---GRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
1e6wA           FLASQVPFPSRLGDPAEYAHLVQMVIEN--PFLNGEVIRLDGAIR-----------------
3bmeB           RKVPLG---RREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
3bmqC           RKVPL---GRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
3bmdB           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
3bmnD           RKVPLG---RREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
3bmnC           RKVPL---GRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
2bfaA           SKVPL---YQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
3bmfA           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
1e6wC           FLASQVPFPSRLGDPAEYAHLVQMVIEN--PFLNGEVIRLDGAIR-----------------
1di7A           --------------------------------------------------------------
2c7vB           RKVPLG---RREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
2bfpB           SKVPL---YQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
2dfdA           VDFPQD-QLTALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNEGVVECSFV
3bmeA           RKVPL---GRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
3bmqA           RKVPLG---RREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
2bf7A           SKVPL---YQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
3bmfB           RKVPL---GRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
2e6cD           GEDPMGRPFYWAPRPLKEAEEGTDRWAVAQGFVSATPLRLDLTDE-----------------
1e7wA           SKVPL---YQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
2bd0A           WGKVDDEMQALMMMPEDIAAPVVQAYLQPSRTVVEEIIRPTSG-------------------
2a92C           GGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAES--------
1di6A           --------------------------------------------------------------
3d7lF           -SWDKLEPFFEGFLPVPAAKVARAFEKSVFGAQTGESYQV----------------------
2c7vC           RKVPL---GRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
3bmjD           RKVPLG---RREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
2cnbA           --------------------------------------------------------------
2e6bC           GEDPMGRPFYWFAPRLKEAEEGTDRWAVAQGFVSATPLRLDLTDE-----------------
2e6bD           GEDRPFYWFAPRPLKEAEEGTDRWAVAQ--GFVSATPLRLDLTDE-----------------
3bmoC           RKVPLG---RREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
3bmfC           KWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
1a4uA           PR-VAELLLSHPTQTSEQCGQNFVKAIE--ANKNGAIWKLDLGT------------------
3bmnA           RKVPLG---RREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH--------------
2bfmB           SKVPL---YQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
2e6hC           GEDPMGRPFYWAPRPLKEAEEGTDRWAVAQGFVSATPLRLDLTDETR---------------
1d4gA           -AQYLGMPINGPFKPDHY--------------------------------------------
1ek5A           NNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAA-------------
1e7wB           GHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
1e92A           GHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
3d64A           KAGPFKPDHYR---------------------------------------------------
3dfzA           --------------------------------------------------------------
1c9kB           --------------------------------------------------------------
2bfaC           -VRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
2e6eD           --------------------------------------------------------------
3e48A           SYDKEASGTEIKYEPVSL--------------------------------------------
2bf7B           GHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
1dj3A           YCCDINGKLDVLSGLPEIKLGVSYNQGEKLQSFPGDLDTLEQVQV-----------------
3e8xA           TVSPHFSEITRSITRHDVAKVIAELVDQQ--HTIGKTFEVLNGDTPI---------------
2aw5A           VSDKHGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNK---EAFVRS--------
1bxkA           --------------------------------------------------------------
1e92B           SKVPL---YQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
3dhnA           KDDIVDIVGNSHISVEDYAAAIDELEHP---KHHQERFTIGYLEH-----------------
1cbuC           --------------------------------------------------------------
2bfaD           VHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
2c5eB           AAFCRKAQTSTDRFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREP---------------
1c9kA           --------------------------------------------------------------
3d7lB           -SWDKLEPFFEGFLPVPAAKVARAFEKSVFGAQTGESYQV----------------------
2c54B           --------------------------------------------------------------
1c3vA           LVAHQEVLFGTEGETLTIRHDSLD--------------------------------------
2bf7D           -VRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
1a7aB           --------------------------------------------------------------
2dt8A           --------------------------------------------------------------
1b3rA           -AQYLGMPINGPFKPDHY--------------------------------------------
2axqA           LALRNSAKYWKDGKIETVSSEDLMATAKPYFIYPGYAFVCY-PNRDSTLFKDLYHIPEAET-
1bdmB           HAEVDGRPALELVDMEWYEKVFIPTVAQRGAAI-----------------------------
3dqpA           GLIDINDEVSASNTIGDVADTIKELVTD---HSIGKVISHNGKTA-----------------
2a92A           --------------------------------------------------------------
1cg3A           --------------------------------------------------------------
2e37E           RARIDEGVRRAAYRIIEGKGATYYGIGAGLARLVRAILTDEKGVYTVSA-------------
3bywC           --------------------------------------------------------------
3bywD           --------------------------------------------------------------
2c20A           THLIPLVLQVALGQREKIMMFGDDYNTPDGTCIRDYIHVEDLVAAHFLG-------------
3dtdB           --------------------------------------------------------------
3bywH           --------------------------------------------------------------
1e92C           GHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
1civA           --------------------------------------------------------------
3bywF           --------------------------------------------------------------
2bfmC           GHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
1cg1A           --------------------------------------------------------------
1e7qA           --------------------------------------------------------------
2bfpD           GHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
1e92D           GHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
3bywB           --------------------------------------------------------------
2bkaA           PDSW---ASGHSVPVVTVVRAMLNNVVRP--RDKQMELLENKAIHDLG--------------
1d0iA           --------------------------------------------------------------
3dooA           --------------------------------------------------------------
1a4iA           --------------------------------------------------------------
2bfoC           GHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
3e9nD           ----FVIDAGETTQITNV--------------------------------------------
2eggA           --------------------------------------------------------------
3c0bC           FA------------------------------------------------------------
1d4fA           -AQYLGMPINGPFKPDHY--------------------------------------------
2bf7C           GHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYS-----------------
3e9nE           ----FVIDAGETTQITNV--------------------------------------------
3bywA           --------------------------------------------------------------
2e6eB           GEDPMGRPFYW---------------------------------------------------
3e9nC           --------------------------------------------------------------
3c3xA           TVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQ---------------
2ef0A           --------------------------------------------------------------
3e9nA           ---------EIYIEPKEIANAIRFVIDAGETTQITNV-------------------------