[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK86654.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bjoA.bssp"
#ERROR : Can't open dsspfile "3eerA.bssp"
#ERROR : Can't open dsspfile "2e8eA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"

## Summary of PDB Search
:140
    8e-36  47%  2bjoA  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN OHRB
    3e-30  50%  3eerA  [x.x.x] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN,
    3e-24  15%  2e8eA  [x.x.x] HYPOTHETICAL PROTEIN AQ_1549
    6e-13  17%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    4e-12  16%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
:140

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxILYTTKASATGGRAGNAKSEDGVLDVTLTVPKELGGDGARGTNPEQLFAAGYSACFLGALKAVAGKHK
2bjoA           ---LFTAKVTARGGRAGHITSDDGVLDFDIVMPNAAAAGQT-GTNPEQLFAAGYAACFGGALEHVAKEQN
3eerA           --TIYQTSATASAGRNGVVSTEDKLLELNLSYPKEGGSGT--ATNPEQLFAVGYAACFSNAILHVAREAK
2e8eA           ---------------------------LSKTSIGEITAGEK-GLNPMELLLVSIGSCSGVDVYHILKKKR
2d7vA           ---DSEAFTDNQYSRAHTWEFDGGSASASPHVVPVPLSVEA-NVDPEEAFVAALSSCHLVFLSIAAKQRY
2d7vB           ---DSEAFTDNQYSRAHTWEFDGGSKILASASPVPVPLSVEANVDPEEAFVAALSSCHLVFLSIAAKQRY


                         .         .         *         .         .         .         .:140
query           VKIPEDTTVTATVGIGPREDGTGFGIEVTLKVNIPGLEREKAEELVAAAHIVCPYSHAMRTSTEVPVSVx
2bjoA           IEIDSEIEGQVSLMKDE--SDGGFKIGVTLVVNTKDLDREKAQELVNAAHEFCPYSKATRGNVDVKLEL-
3eerA           VAL-KEAPVTATVGIGPNGQG-GFALSVALAA-HIALEDEQARQLVTVAHQVCPYSNAVRGNIDVQVSV-
2e8eA           QEV-KDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISW-
2d7vA           LVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGKPTLQQLEKHHLAHENCFIANSVETEVVTEI---
2d7vB           LVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGKPTLQQLEKHHLAHENCFIANSVETEVVTEI---