[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK86734.2

[Show Plain Result]

#ERROR : Can't open dsspfile "2e8iA.bssp"
#ERROR : Can't open dsspfile "2dcfA.bssp"
#ERROR : Can't open dsspfile "2dd0F.bssp"
#ERROR : Can't open dsspfile "2dnsF.bssp"
#ERROR : Can't open dsspfile "2efxF.bssp"
#ERROR : Can't open dsspfile "2efuF.bssp"
#ERROR : Can't open dsspfile "1ci9A.bssp"
#ERROR : Can't open dsspfile "2efuC.bssp"
#ERROR : Can't open dsspfile "2efuB.bssp"
#ERROR : Can't open dsspfile "2dd0E.bssp"
#ERROR : Can't open dsspfile "2dnsD.bssp"
#ERROR : Can't open dsspfile "1cegA.bssp"
#ERROR : Can't open dsspfile "2drwC.bssp"
#ERROR : Can't open dsspfile "2drwF.bssp"
#ERROR : Can't open dsspfile "2blsA.bssp"
#ERROR : Can't open dsspfile "2dnsA.bssp"
#ERROR : Can't open dsspfile "2dnsC.bssp"
#ERROR : Can't open dsspfile "2drwD.bssp"
#ERROR : Can't open dsspfile "1ei5A.bssp"
#ERROR : Can't open dsspfile "2dnsE.bssp"
#ERROR : Can't open dsspfile "2efuE.bssp"
#ERROR : Can't open dsspfile "2drwE.bssp"

## Summary of PDB Search
:435
    9e-36  30%  2e8iA  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    5e-31  29%  2dcfA  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    7e-23  17%  2dd0F  [x.x.x] D-AMINO ACID AMIDASE
    1e-22  18%  2dnsF  [x.x.x] D-AMINO ACID AMIDASE
    2e-22  17%  2efxF  [x.x.x] D-AMINO ACID AMIDASE
    8e-22  18%  2efuF  [x.x.x] D-AMINO ACID AMIDASE
    5e-21  21%  1ci9A  [e.3.1] PROTEIN (CARBOXYLESTERASE)
    5e-21  15%  2efuC  [x.x.x] D-AMINO ACID AMIDASE
    5e-21  17%  2efuB  [x.x.x] D-AMINO ACID AMIDASE
    1e-20  18%  2dd0E  [x.x.x] D-AMINO ACID AMIDASE
    4e-20  17%  2dnsD  [x.x.x] D-AMINO ACID AMIDASE
    8e-20  17%  1cegA  [x.x.x] D-ALANYL-D-ALANINE CARBOXYPEPTIDASE
    1e-19  17%  2drwC  [x.x.x] D-AMINO ACID AMIDASE
    2e-19  18%  2drwF  [x.x.x] D-AMINO ACID AMIDASE
    7e-19  15%  2blsA  [e.3.1] AMPC BETA-LACTAMASE
    8e-18  15%  2dnsA  [x.x.x] D-AMINO ACID AMIDASE
    1e-17  16%  2dnsC  [x.x.x] D-AMINO ACID AMIDASE
    4e-17  18%  2drwD  [x.x.x] D-AMINO ACID AMIDASE
    2e-16  17%  1ei5A  [e.3.1 - b.61.3 - b.61.3] D-AMINOPEPTIDASE
    5e-14  15%  2dnsE  [x.x.x] D-AMINO ACID AMIDASE
    3e-13  16%  2efuE  [x.x.x] D-AMINO ACID AMIDASE
    8e-11  16%  2drwE  [x.x.x] D-AMINO ACID AMIDASE
:435

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMQGFPPPEDKIIRFSDSDYFNFPKSRWTVCHFRQL
2e8iA           -----------------------------------PARYPGAAAGEPTLDS--WQEPPHNRWAFAHLGEM
2dcfA           -------------------------------------RYPGAAAGEPTLDS--WQEPPHNRWAFAHLGEM
2dd0F           ----------------------------------------------------------------------
2dnsF           ----------------------------------------------------------------------
2efxF           ----------------------------------------------------------------------
2efuF           ----------------------------------------------------------------------
1ci9A           ----------------------------------------------------------------------
2efuC           ----------------------------------------------------------------------
2efuB           ----------------------------------------------------------------------
2dd0E           ----------------------------------------------------------------------
2dnsD           ----------------------------------------------------------------------
1cegA           ----------------------------------------------------------------------
2drwC           ----------------------------------------------------------------------
2drwF           ----------------------------------------------------------------------
2blsA           ----------------------------------------------------------------------
2dnsA           ----------------------------------------------------------------------
2dnsC           ----------------------------------------------------------------------
2drwD           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
2dnsE           ----------------------------------------------------------------------
2efuE           ----------------------------------------------------------------------
2drwE           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MPTVNVSRGLGAPAALERKLDPAMDAVTFRPTGADQDMTWLQSLSANYTDGIVVLHKGVLVYERYSGCLN
2e8iA           VPSAAVSRRPGHALARLGAIAAQLPDLE-------------QRLEQTYTDAFLVLRGTEVVAEYYRAGFA
2dcfA           VPSAAVSR-RPGHALARLGAIAAQLPDLEQRLEQT------------YTDAFLVLRGTEVVAEYYRAGFA
2dd0F           ---------------------------------------------------LALCLPGEETSLYQSGYAD
2dnsF           ----------------------------------------------------GILDDHVAALCEETSPMT
2efxF           --------------------------------------------------GILDVAGSALCLPGETSYAK
2efuF           ---------------------------------------------------LALCLPGEETSLYQSGYAD
1ci9A           ---------------------------------------------------AIVARHGEILYRRAQGLAD
2efuC           ---------------------------------------------------LALCLPGEETSLYQSGYAD
2efuB           ---------------------------------------------------LALCLPGEETSLYQSGYAD
2dd0E           ---------------------------------------------------LALCLPGEETSLYQSGYAD
2dnsD           ---------------------------------------------------LALCLPGEETSLYQSGYAD
1cegA           ------------------------------DLPAPDDTGLQAVLHTALSQGARVDDNGTIHQLSEGVAIT
2drwC           ---------------------------------------------------LALCLPGEETSLYQSGYAD
2drwF           ----------------------------------------LDDHVARGVVGVSLALPGEETSLYQSGYAD
2blsA           ---------------------------------------------AVIYQGKPYYFTWGYADIAKKQPVT
2dnsA           ---------------------------------------------------LALCLPGEETSLYQSGYAD
2dnsC           ---------------------------------------------------LALCLPGEETSLYQSGYAD
2drwD           ---------------------------------------------------LALCLPGEETSLYQSGYAD
1ei5A           ---------------------------------------------------VAVVKDGEVVLQHAWGFAD
2dnsE           ---------------------------------------------ALCLPGEETSLYQSGYADKKM-PMT
2efuE           ---------------------------------------------ALCLPGEETSLYQSGYADKFNMPMT
2drwE           ---------------------------------------------ALCLPGEETSLYQSGYADKNKMPMT


                         +         .         .         .         .         *         .:210
query           EAGQHGAMSVTKSLTGLLGEMLVAEGTLDENAKVATVVPELEKSAFGDATIRQVLDMTTGLRYSEDYADP
2e8iA           PDDRHLLMSVSKSLCGTVVGALVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDY---NEDY
2dcfA           PDDRHLLMAVSKSLCGTVVGALVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDY---NEDY
2dd0F           KFNKMPMASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKAA--QMPVRILLNHRSGLPDFETS---
2dnsF           GDHLFRIASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKAA--QMPVRILLNHRSGLPDFETSMPM
2efxF           GDHLFRIASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKA--AQMPVRILLNHRSGLPDFET----
2efuF           KMPLFRIASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKAA--QMPVRILLNHRSGLPDFETS---
1ci9A           REAGRPMASVTKPIVALAVLRLVARGELALDAPVTRWLPEFRPRLAPLVTIHHLLTHTSGLGYWLLEGA-
2efuC           KFNKMPMASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKA--AQMPVRILLNHRSGLPDFETS---
2efuB           KFNKMPMASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKAA--QMPVRILLNHRSGLPDFETSMPM
2dd0E           KFNKMPMASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKA--AQMPVRILLNHRSGLPDFETSMPM
2dnsD           KFNKMPMASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKA--AQMPVRILLNHRSGLPDFETSMPM
1cegA           TTDRFRVGSVTKSFSAVVLLQLVDEGKLDLDASVNTYLPGLLP--DDRITVRQVMSHRSGLYDYTNDM--
2drwC           KFNKMPMASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKA--AQMPVRILLNHRSGLPDFETSMPM
2drwF           KMPLFRIASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKAA--QMPVRILLNHRSGLPDFETS---
2blsA           QQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEV
2dnsA           KFNKMPMASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDL--PKAAQMPVRILLNHRSGLPDFETS---
2dnsC           KFNKMPMASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKA--AQMPVRILLNHRSGLPDFETS---
2drwD           KFNKMPMASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKAA--QMPVRILLNHRSGLPDFETS---
1ei5A           LRTRMPICSVSKQFTCAVLLDAVGEPELLDDALEAYLDKFE----DERPAVRDLCNNQSGLRDYWALSVL
2dnsE           GDHLFRIASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKA--AQMPVRILLNHRSGLPDFETSM--
2efuE           GDHLFRIASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKA--AQMPVRILLNHRSGLPDFE-----
2drwE           GDHLFRIASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKA--AQMPVRILLNHRSGLPDFETSMPM


                         .         .         .         +         .         .         .:280
query           NADVWIYSAAGNPLPKPDGYEGPRSYFDYLKTVVKQGENGSAFGYKTINSDALGWVIARASGKSVAELLS
2e8iA           VDPASEVQTHDRSAGWRTRRHGDPADTYEFLTTLRGDGSTGEFQYCSANTDVLAWIVERVTGLRYVEALS
2dcfA           VDPASEVQTHDRSAGWRTRRHGDPADTYEFLTTLRGDGSTGEFQYCSANTDVLAWIVERVTGLRYVEALS
2dd0F           ------------MPMISDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
2dnsF           I---------------SDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
2efxF           -----------SMPMISDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
2efuF           ------------MPMISDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
1ci9A           ---GSVYDRLGISDGIDLRDFDLDENLRRLASAPLSFAPGSGWQYSL-ALDVLGAVVERATGQPLAAAVD
2efuC           ------------MPMISDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
2efuB           ISDKSW---------------TAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
2dd0E           I---------------SDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
2dnsD           ISDKS---------------WTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
1cegA           -----FAQTVPGFESVRNKVFSYQDLITLSLKHGVTNAPGAAYSYSNTNFVVAGMLIEKLTGHSVATEYQ
2drwC           I---------------SDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
2drwF           ------------MPMISDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
2blsA           K--------------------SSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQ
2dnsA           ------------MPMISDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
2dnsC           ------------MPMISDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
2drwD           ------------MPMISDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
1ei5A           CGADP-----------EGVFLPAQAQSLLRRLKTTHFEPGSHYSYCNGNFRILADLIEAHTGRTLVDILS
2dnsE           -------------PMISDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
2efuE           ----------TSMPMISDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
2drwE           ISDKSWTAQE---IVDFSFRHGVQKEP------------WHGMEYSNTGYVLAGMIIAHETGKPYSDHLR


                         .         *         .         .         .         .         +:350
query           QRIWSRIGAEQDAYYTVDSTGTPFAGGGLNAGLRDMARIGQLLLDDGMAGGHRLIPQKAIDNIRHGGDKA
2e8iA           TYLWAKLDADRDATITVDTTGFGFAHGGVSCTARDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHE
2dcfA           TYLWAKLDADRDATITVDTTGFGFANGGVSCTARDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGHEA
2dd0F           SRIFAPLGMKDTWVGEWFPLSGANAAGDMVSTPRDIVKFLNALFDGRILDQKR---LWEMKDNIKPAFFP
2dnsF           SRIFAPLGMKDTWVGTHEPLSGANAAGDMVSTPRDIVKFLNALFDGRILDQKRLWEMKDNIKPAFFPG--
2efxF           SRIPLGDVAGMHAWDSTWFPLSGANAAGDMSTPRDIVKFLNALFDGRILDQKRLWEMKDNIKPAF-----
2efuF           SRIFAPLGMKDTWVGEWFPLSGANAAGDMVSTPRDIVKFLNALFDGRILDQKRLWEMKDN----------
1ci9A           ALVAQPLGMRDCGFVSAEPERFAVPYHDGQPEPDDVLRALEAIRANPGFLPETLADAARRDQA-GVGAET
2efuC           SRIFAPLGMKDTWVGTHETFPIEREARGYMHAAADDENPQWDVSGAGDPVDGVWDSTEWFPLSGANAAGD
2efuB           SRIFAPLGMKDTWVGTHETFPIEREAGDMVSTPRDIVKFLNALFDGRILDQKRLWEMKDNI---------
2dd0E           SRIFAPLGMKDTWVGEWFPLSGANAAGDMVSTPRDIVKFLNALFDGRILDQKRLWEMKDNIKPAF-----
2dnsD           SRIFAPLGMKDTWVGTHETFPIEREARGYMHA-AAPQWDGAGDPVDGVWDSTELFDGRILDQKRLWEMKD
1cegA           NRIFTPLNLTDTFYVTEQTVSWAQSAGAVISSTQDLDTFFSALMSGQLMSAAQLAQMQQWTTVNSTQGYG
2drwC           SRIFAPLGMKDTWVGEWFPLSGANAAGDMVSTPRDIVKFLNALFDGRILDQKRLWEMKDN----------
2drwF           SRIFAPLGMKDTWVGEWFPLSGANAAGDMVSTPRDIVKFLNALFDGR------ILDQKRLWEMKD-----
2blsA           TRVFQPLKLNEGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRPVNPDS
2dnsA           SRIFAPLGMKDTWVGTHETFPIEREARGYMHAAADDENPQWDVSGAGDPVDGVWDSTEWFPLSGANAAGD
2dnsC           SRIFAPLGMKDTWVGTHETFPIEREARGYMHAAADDENPQTEWFPLSGANAAGLFDGRILDQKRLWEMKD
2drwD           SRIFAPLGMKDTWVGEWFPLSGANAAGDMVSTPRDIVKFLNALFDGRILDQKRLWEMKDN----------
1ei5A           ERIFAPEGDTVRGFLPATNRIQWMGDAGICASLNDMIAWEQFIDATRDDESGLYRRLSGPQTFKD-----
2dnsE           SRIFAPLGMKDTWVGTHETFPIEREARGYMHAWDSGAGDPVDGVWDSGANAAGDMVSTPRDIVKFLNAKD
2efuE           SRIFAPLGMKDTWVGTHETFPIEREARGYMHAGVWDSTEWFPLPRDIVKFLNALFDGRILDQKRLWEMKD
2drwE           SRIFAPLGMKDTWVGTHETFPIEREARGYMHAPVDGVWDSTEWFPLSALFDGRILDQKRLWEMKDNIKPA


                         .         .         .         .         *         .         .:420
query           AFAKGGYPALRGWSYRAMWWVTHNANGAFMARGVHGQAIYVDPAADMVIARFSSHPVASNAANDPTSLPA
2e8iA           ATDKGFTNTFPDGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPLTDSVIVKLSSWPDPDTEHWHRLQNGI
2dcfA           MTDKGFTNTFPDGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPLTDSVIVKLSSWPDPDTEHWHRLQNGI
2dd0F           GSNTVANGH--GLLLMRYGSSE--LKGHLGQIPGHTSIMGRDEETGAALMLIQN---SGAGDFESFYLKG
2dnsF           -----SNTVANGHGLLLMRYGSSELKGHLGQIPGHTSIMGRDEETGAALMLIQNSGAGDSFY--------
2efxF           ------FPGSNTVANGHGLLLMRYGSGHLGQIPGHTSIMGRDEETGAALMLI----QSGAGDFESFYLKG
2efuF           -IKPAFFPGSNTVANGHGLLLMRYGSGHLGQIPGHTSIMGRDEETGAALMLIQNSGAGDFES--------
1ci9A           RGPGWGFGYLSAVLDDPAAAGTPQHAGTLQWGGVYGHSWFVDRALGLSVL------LLTNTAYEGMSGPL
2efuC           MVSPAFFPGSNTVANGHGLLLMRYGSGHLGQIPGHTSIMGRDEETGAALM------LIQNSGAGDFESFY
2efuB           --KPAFFPGSNTVANGHGLLLMRYGSSHLGQIPGHTSIMGRDEETGAALMLIQGAGDFESFYLKGVNEPV
2dd0E           --FPGSNTVANGHGLLLMRYGSSELKGHLGQIPGHTSIMGRDEETGAALMLIQN---SGAGDFESFYLKG
2dnsD           NIKPAFFPGSNTVANGHGLLLMRYGSGHLGQIPGHTSIMGRDEETGAALMLIQNSG---AGDFESFYLKG
1cegA           L----------GL-RRRDLSCGISVYGHTGTVQGYYTYAFASKDGKRSVTALANTSNNVNVLNT------
2drwC           -IKPAFFPGSNTVANGHGLLLMRYGSGHLGQIPGHTSIMGRDEETGAALMLIQNS---GAGDFESFYLKG
2drwF           NIKPAFFPGSNTVANGHGLLLMRYGSGHLGQIPGHTSIMGRDEETGAALMLIQNSGAGDFES--------
2blsA           IINGSDNKIALAARPVKAITPPTPAVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPAR-----VDA
2dnsA           MVSPAFFPGSNTVANGHGLLLMRYGSGHLGQIPGHTSIMGRDEETGAALMLIQGAGDFESFYLKGVNEPV
2dnsC           NIKPAFFPGSNTVANGHGLLLMRYGSGHLGQIPGHTSIMGRDEETGAALMLIQGAGDFESFYLKGVNEPV
2drwD           -IKPAFFPGSNTVANGHGLLLMRYGSGHLGQIPGHTSIMGRDEETGAALMLIQNSGAGDFES--------
1ei5A           ----------------------------------------------------------------------
2dnsE           NIKPAFFPGSNTVANGHGLLLMRELKGHLGQIPGHTSIMGRDEETGAALMLIQNSG---AGDFESFYLKG
2efuE           NIKPAFFPGSNTVANGHGLLLMRYGSGHLGQIPGHTSIMGRDEETGAALMLIQNSGAGDFES--------
2drwE           FFPGSNTVA-NGHGLLLMRYGSSELKGHLGQIPGHTSIMGRDEETGAALMLIQNS-------GAGDFESF


                         .         .         +         .         .         .         .:490
query           YEAVARYLMGGxxxx
2e8iA           LLDVSRAL-------
2dcfA           LLDVSRAL-------
2dd0F           VNEPVDRVL------
2dnsF           ---------------
2efxF           VNEPVDRVEAI----
2efuF           ---------------
1ci9A           TIALRDAVYA-----
2efuC           LKGVNEPV-------
2efuB           DRVLE----------
2dd0E           VNEPVDRVL------
2dnsD           VNEPVDRVLEA----
1cegA           ---------------
2drwC           VNEPVDRVLEA----
2drwF           ---------------
2blsA           AWQILNAL-------
2dnsA           DRVLE----------
2dnsC           DRVLE----------
2drwD           ---------------
1ei5A           ---------------
2dnsE           VNEPVDRVLEA----
2efuE           ---------------
2drwE           YLKGVNEPV------