[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK86736.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dwkB.bssp"
#ERROR : Can't open dsspfile "3dwkC.bssp"
#ERROR : Can't open dsspfile "3dwkD.bssp"
#ERROR : Can't open dsspfile "2bg1A.bssp"
#ERROR : Can't open dsspfile "2bg4A.bssp"
#ERROR : Can't open dsspfile "2bg4B.bssp"
#ERROR : Can't open dsspfile "3dwkA.bssp"
#ERROR : Can't open dsspfile "2c5wB.bssp"
#ERROR : Can't open dsspfile "3d3hA.bssp"
#ERROR : Can't open dsspfile "2c6wB.bssp"
#ERROR : Can't open dsspfile "2drwE.bssp"
#ERROR : Can't open dsspfile "3czdA.bssp"
#ERROR : Can't open dsspfile "1alqA.bssp"
#ERROR : Can't open dsspfile "1e4dA.bssp"
#ERROR : Can't open dsspfile "1bsgA.bssp"
#ERROR : Can't open dsspfile "1e4dB.bssp"
#ERROR : Can't open dsspfile "3e2lA.bssp"
#ERROR : Can't open dsspfile "1ck3A.bssp"
#ERROR : Can't open dsspfile "3cmzA.bssp"
#ERROR : Can't open dsspfile "2b5rA.bssp"
#ERROR : Can't open dsspfile "1e4dC.bssp"
#ERROR : Can't open dsspfile "4blmA.bssp"
#ERROR : Can't open dsspfile "3bffA.bssp"
#ERROR : Can't open dsspfile "1e3uA.bssp"
#ERROR : Can't open dsspfile "3cjmA.bssp"
#ERROR : Can't open dsspfile "1blpA.bssp"
#ERROR : Can't open dsspfile "3dtmA.bssp"
#ERROR : Can't open dsspfile "1bt5A.bssp"
#ERROR : Can't open dsspfile "1e3uD.bssp"
#ERROR : Can't open dsspfile "3dw0A.bssp"
#ERROR : Can't open dsspfile "1djbA.bssp"
#ERROR : Can't open dsspfile "1dy6A.bssp"
#ERROR : Can't open dsspfile "1e3uC.bssp"
#ERROR : Can't open dsspfile "3bydA.bssp"
#ERROR : Can't open dsspfile "1blcA.bssp"
#ERROR : Can't open dsspfile "1e25A.bssp"
#ERROR : Can't open dsspfile "3bfdA.bssp"
#ERROR : Can't open dsspfile "3bfeA.bssp"
#ERROR : Can't open dsspfile "3dw0B.bssp"
#ERROR : Can't open dsspfile "1djaA.bssp"
#ERROR : Can't open dsspfile "3e2kA.bssp"
#ERROR : Can't open dsspfile "3c5aA.bssp"
#ERROR : Can't open dsspfile "2dnsE.bssp"
#ERROR : Can't open dsspfile "2cc1A.bssp"
#ERROR : Can't open dsspfile "2bc3A.bssp"
#ERROR : Can't open dsspfile "2bc3B.bssp"
#ERROR : Can't open dsspfile "1bzaA.bssp"
#ERROR : Can't open dsspfile "2bcfA.bssp"
#ERROR : Can't open dsspfile "3brmA.bssp"
#ERROR : Can't open dsspfile "2blsA.bssp"
#ERROR : Can't open dsspfile "1bueA.bssp"
#ERROR : Can't open dsspfile "2efuE.bssp"
#ERROR : Can't open dsspfile "2e8iA.bssp"
#ERROR : Can't open dsspfile "2bsbA.bssp"
#ERROR : Can't open dsspfile "1dkiC.bssp"
#ERROR : Can't open dsspfile "3by7D.bssp"
#ERROR : Can't open dsspfile "2dnsA.bssp"
#ERROR : Can't open dsspfile "2d0aA.bssp"
#ERROR : Can't open dsspfile "1ci9A.bssp"
#ERROR : Can't open dsspfile "3brmB.bssp"
#ERROR : Can't open dsspfile "2dcfA.bssp"
#ERROR : Can't open dsspfile "3e2lB.bssp"
#ERROR : Can't open dsspfile "2dnsC.bssp"
#ERROR : Can't open dsspfile "2drwD.bssp"

## Summary of PDB Search
:757
    6e-92  25%  3dwkB  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    2e-91  25%  3dwkC  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    3e-75  25%  3dwkD  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    2e-64  19%  2bg1A  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    1e-58  20%  2bg4A  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    9e-56  21%  2bg4B  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    3e-53  23%  3dwkA  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    8e-52  25%  2c5wB  [x.x.x] PENICILLIN-BINDING PROTEIN 1A
    5e-51  46%  3d3hA  [x.x.x] PENICILLIN-INSENSITIVE TRANSGLYCOSYLASE
    3e-50  24%  2c6wB  [x.x.x] PENICILLIN-BINDING PROTEIN 1A
    3e-35  10%  2drwE  [x.x.x] D-AMINO ACID AMIDASE
    1e-34  11%  3czdA  [x.x.x] GLUTAMINASE KIDNEY ISOFORM
    2e-30  16%  1alqA  [x.x.x] CP254 BETA-LACTAMASE
    1e-28  15%  1e4dA  [e.3.1] BETA-LACTAMASE OXA-10
    1e-27  16%  1bsgA  [x.x.x] BETA LACTAMASE
    1e-27  15%  1e4dB  [e.3.1] BETA-LACTAMASE OXA-10
    2e-27  12%  3e2lA  [x.x.x] CARBAPENEMASE
    4e-27  14%  1ck3A  [e.3.1] BETA-LACTAMASE
    1e-26  13%  3cmzA  [x.x.x] BETA-LACTAMASE TEM
    3e-26  14%  2b5rA  [x.x.x] BETA-LACTAMASE TEM
    1e-25  15%  1e4dC  [e.3.1] BETA-LACTAMASE OXA-10
    2e-25  14%  4blmA  [e.3.1] BETA-LACTAMASE
    3e-25  14%  3bffA  [x.x.x] CLASS A BETA-LACTAMASE SED1
    3e-25  17%  1e3uA  [e.3.1] BETA-LACTAMASE OXA-10
    8e-25  11%  3cjmA  [x.x.x] PUTATIVE BETA-LACTAMASE
    1e-24  14%  1blpA  [x.x.x] BETA-LACTAMASE
    3e-24  13%  3dtmA  [x.x.x] BETA-LACTAMASE
    3e-24  14%  1bt5A  [e.3.1] PROTEIN (BETA-LACTAMASE)
    4e-24  17%  1e3uD  [e.3.1] BETA-LACTAMASE OXA-10
    5e-24  16%  3dw0A  [x.x.x] CLASS A CARBAPENEMASE KPC-2
    6e-24  14%  1djbA  [x.x.x] BETA-LACTAMASE
    2e-22  13%  1dy6A  [e.3.1] CARBAPENEM-HYDROLYSING BETA-LACTAMASE SME-1
    3e-22  17%  1e3uC  [e.3.1] BETA-LACTAMASE OXA-10
    4e-22  14%  3bydA  [x.x.x] BETA-LACTAMASE OXY-1
    5e-22  14%  1blcA  [x.x.x] BETA-LACTAMASE
    1e-21  13%  1e25A  [e.3.1] EXTENDED-SPECTRUM BETA-LACTAMASE PER-1
    1e-21  14%  3bfdA  [x.x.x] CLASS A BETA-LACTAMASE SED1
    2e-21  13%  3bfeA  [x.x.x] CLASS A BETA-LACTAMASE SED1
    5e-21  14%  3dw0B  [x.x.x] CLASS A CARBAPENEMASE KPC-2
    8e-21  14%  1djaA  [x.x.x] BETA-LACTAMASE
    1e-20  14%  3e2kA  [x.x.x] CARBAPENEMASE
    3e-20  15%  3c5aA  [x.x.x] CLASS A CARBAPENEMASE KPC-2
    5e-20   8%  2dnsE  [x.x.x] D-AMINO ACID AMIDASE
    2e-19  15%  2cc1A  [e.3.1 (1mfoA)] BETA-LACTAMASE
    2e-19  11%  2bc3A  [x.x.x] STREPTAVIDIN
    1e-18  12%  2bc3B  [x.x.x] STREPTAVIDIN
    1e-18  13%  1bzaA  [x.x.x] BETA-LACTAMASE
    8e-18  17%  2bcfA  [x.x.x] PROBABLE D-ALANYL-D-ALANINE CARBOXYPEPTIDASE
    4e-16  14%  3brmA  [x.x.x] GLUTAMINASE 1
    8e-16  13%  2blsA  [e.3.1] AMPC BETA-LACTAMASE
    2e-15  12%  1bueA  [e.3.1] PROTEIN (IMIPENEM-HYDROLYSING BETA-LACTAMASE)
    3e-14  12%  2efuE  [x.x.x] D-AMINO ACID AMIDASE
    3e-14   9%  2e8iA  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    8e-13  10%  2bsbA  [x.x.x] F17G ADHESIN SUBUNIT
    6e-12   6%  1dkiC  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    5e-11   6%  3by7D  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-10  12%  2dnsA  [x.x.x] D-AMINO ACID AMIDASE
    1e-08   6%  2d0aA  [x.x.x] RIBONUCLEASE HIII
    6e-08  11%  1ci9A  [e.3.1] PROTEIN (CARBOXYLESTERASE)
    3e-07  21%  3brmB  [x.x.x] GLUTAMINASE 1
    2e-05  10%  2dcfA  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    2e-05  22%  3e2lB  [x.x.x] CARBAPENEMASE
    8e-05  11%  2dnsC  [x.x.x] D-AMINO ACID AMIDASE
    7e-04  10%  2drwD  [x.x.x] D-AMINO ACID AMIDASE
:757

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dwkB           ----------------------------------------------------------------------
3dwkC           ----------------------------------------------------------------------
3dwkD           ----------------------------------------------------------------------
2bg1A           ----------------------------------------------------------------------
2bg4A           ----------------------------------------------------------------------
2bg4B           ----------------------------------------------------------------------
3dwkA           ----------------------------------------------------------------------
2c5wB           ----------------------------------------------------------------------
3d3hA           ----------------------------------------------------------------------
2c6wB           ----------------------------------------------------------------------
2drwE           ----------------------------------------------------------------------
3czdA           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
1e4dA           ----------------------------------------------------------------------
1bsgA           ----------------------------------------------------------------------
1e4dB           ----------------------------------------------------------------------
3e2lA           ----------------------------------------------------------------------
1ck3A           ----------------------------------------------------------------------
3cmzA           ----------------------------------------------------------------------
2b5rA           ----------------------------------------------------------------------
1e4dC           ----------------------------------------------------------------------
4blmA           ----------------------------------------------------------------------
3bffA           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
3cjmA           ----------------------------------------------------------------------
1blpA           ----------------------------------------------------------------------
3dtmA           ----------------------------------------------------------------------
1bt5A           ----------------------------------------------------------------------
1e3uD           ----------------------------------------------------------------------
3dw0A           ----------------------------------------------------------------------
1djbA           ----------------------------------------------------------------------
1dy6A           ----------------------------------------------------------------------
1e3uC           ----------------------------------------------------------------------
3bydA           ----------------------------------------------------------------------
1blcA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
3bfdA           ----------------------------------------------------------------------
3bfeA           ----------------------------------------------------------------------
3dw0B           ----------------------------------------------------------------------
1djaA           ----------------------------------------------------------------------
3e2kA           ----------------------------------------------------------------------
3c5aA           ----------------------------------------------------------------------
2dnsE           ----------------------------------------------------------------------
2cc1A           ----------------------------------------------------------------------
2bc3A           ----------------------------------------------------------------------
2bc3B           ----------------------------------------------------------------------
1bzaA           ----------------------------------------------------------------------
2bcfA           ----------------------------------------------------------------------
3brmA           ----------------------------------------------------------------------
2blsA           ----------------------------------------------------------------------
1bueA           ----------------------------------------------------------------------
2efuE           ----------------------------------------------------------------------
2e8iA           ----------------------------------------------------------------------
2bsbA           ----------------------------------------------------------------------
1dkiC           ----------------------------------------------------------------------
3by7D           ----------------------------------------------------------------------
2dnsA           ----------------------------------------------------------------------
2d0aA           ----------------------------------------------------------------------
1ci9A           ----------------------------------------------------------------------
3brmB           ----------------------------------------------------------------------
2dcfA           ----------------------------------------------------------------------
3e2lB           ----------------------------------------------------------------------
2dnsC           ----------------------------------------------------------------------
2drwD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAVTFLDRYGNTIGHRGI
3dwkB           -----------------------------------------------------PAKIYDKNGELVKTLDG
3dwkC           ------------------------------------------------------AKIYDKNGELVKTDNG
3dwkD           ------------------------------------------------------AKIYDKNGELVKTLD-
2bg1A           ----------------------------------------------------------------------
2bg4A           ----------------------------------------------------------------------
2bg4B           ----------------------------------------------------------------------
3dwkA           ------------------------------------------------------AKIYDKNGELVKLDNG
2c5wB           ----------------------------------------------------------------------
3d3hA           ----------------------------------------------------------------------
2c6wB           ----------------------------------------------------------------------
2drwE           ----------------------------------------------------------------------
3czdA           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
1e4dA           ----------------------------------------------------------------------
1bsgA           ----------------------------------------------------------------------
1e4dB           ----------------------------------------------------------------------
3e2lA           ----------------------------------------------------------------------
1ck3A           ----------------------------------------------------------------------
3cmzA           ----------------------------------------------------------------------
2b5rA           ----------------------------------------------------------------------
1e4dC           ----------------------------------------------------------------------
4blmA           ----------------------------------------------------------------------
3bffA           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
3cjmA           ----------------------------------------------------------------------
1blpA           ----------------------------------------------------------------------
3dtmA           ----------------------------------------------------------------------
1bt5A           ----------------------------------------------------------------------
1e3uD           ----------------------------------------------------------------------
3dw0A           ----------------------------------------------------------------------
1djbA           ----------------------------------------------------------------------
1dy6A           ----------------------------------------------------------------------
1e3uC           ----------------------------------------------------------------------
3bydA           ----------------------------------------------------------------------
1blcA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
3bfdA           ----------------------------------------------------------------------
3bfeA           ----------------------------------------------------------------------
3dw0B           ----------------------------------------------------------------------
1djaA           ----------------------------------------------------------------------
3e2kA           ----------------------------------------------------------------------
3c5aA           ----------------------------------------------------------------------
2dnsE           ----------------------------------------------------------------------
2cc1A           ----------------------------------------------------------------------
2bc3A           ----------------------------------------------------------------------
2bc3B           ----------------------------------------------------------------------
1bzaA           ----------------------------------------------------------------------
2bcfA           ----------------------------------------------------------------------
3brmA           ----------------------------------------------------------------------
2blsA           ----------------------------------------------------------------------
1bueA           ----------------------------------------------------------------------
2efuE           ----------------------------------------------------------------------
2e8iA           ----------------------------------------------------------------------
2bsbA           ----------------------------------------------------------------------
1dkiC           ----------------------------------------------------------------------
3by7D           ----------------------------------------------------------------------
2dnsA           ----------------------------------------------------------------------
2d0aA           ----------------------------------------------------------------------
1ci9A           ----------------------------------------------------------------------
3brmB           ----------------------------------------------------------------------
2dcfA           ----------------------------------------------------------------------
3e2lB           ----------------------------------------------------------------------
2dnsC           ----------------------------------------------------------------------
2drwD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IHEDSVPIDQMPDHFIKAVLATEDRRFFDHFGIDFIGLARAMSENARAGGVVQGGSTLTQQLAKNLFLTN
3dwkB           QRHEHVNLKDVPKSMKDAVLATEDNRFYEHGALDYKRLFGAIGKNLTGGFGSEGASTLTQQVVKDAFLSQ
3dwkC           QRHEHVNLKDVPKSMKDAVLATEDNRFYEHGALDYKRLFGAIGKNLTGGFGSEGASTLTQQVVKDAFLSQ
3dwkD           -RHEHVNLKDVPKSMKDAVLATEDNRFYEHGALDYKRL---------------FASTLTQQVVKDAFLSQ
2bg1A           ----------------------------------------------------------------------
2bg4A           ----------------------------------------------------------------------
2bg4B           ----------------------------------------------------------------------
3dwkA           QRHEHVNLKDVPKSMKDAVLATEDNRFYEHGALDYKR---------------LFGSTLTQQVVKDAFLSI
2c5wB           ----------------------------------------------------------------------
3d3hA           -KRFYVSIDKIPEHVINAFVATEDRNFWHHFGIDPVAIVRA---------AIQGGSTITQQLAKNLFLTR
2c6wB           ----------------------------------------------------------------------
2drwE           ----------------------------------------------------------------------
3czdA           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
1e4dA           ----------------------------------------------------------------------
1bsgA           ----------------------------------------------------------------------
1e4dB           ----------------------------------------------------------------------
3e2lA           ----------------------------------------------------------------------
1ck3A           ----------------------------------------------------------------------
3cmzA           ----------------------------------------------------------------------
2b5rA           ----------------------------------------------------------------------
1e4dC           ----------------------------------------------------------------------
4blmA           ----------------------------------------------------------------------
3bffA           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
3cjmA           ----------------------------------------------------------------------
1blpA           ----------------------------------------------------------------------
3dtmA           ----------------------------------------------------------------------
1bt5A           ----------------------------------------------------------------------
1e3uD           ----------------------------------------------------------------------
3dw0A           ----------------------------------------------------------------------
1djbA           ----------------------------------------------------------------------
1dy6A           ----------------------------------------------------------------------
1e3uC           ----------------------------------------------------------------------
3bydA           ----------------------------------------------------------------------
1blcA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
3bfdA           ----------------------------------------------------------------------
3bfeA           ----------------------------------------------------------------------
3dw0B           ----------------------------------------------------------------------
1djaA           ----------------------------------------------------------------------
3e2kA           ----------------------------------------------------------------------
3c5aA           ----------------------------------------------------------------------
2dnsE           ----------------------------------------------------------------------
2cc1A           ----------------------------------------------------------------------
2bc3A           ----------------------------------------------------------------------
2bc3B           ----------------------------------------------------------------------
1bzaA           ----------------------------------------------------------------------
2bcfA           ----------------------------------------------------------------------
3brmA           ----------------------------------------------------------------------
2blsA           ----------------------------------------------------------------------
1bueA           ----------------------------------------------------------------------
2efuE           ----------------------------------------------------------------------
2e8iA           ----------------------------------------------------------------------
2bsbA           ----------------------------------------------------------------------
1dkiC           ----------------------------------------------------------------------
3by7D           ----------------------------------------------------------------------
2dnsA           ----------------------------------------------------------------------
2d0aA           ----------------------------------------------------------------------
1ci9A           ----------------------------------------------------------------------
3brmB           ----------------------------------------------------------------------
2dcfA           ----------------------------------------------------------------------
3e2lB           ----------------------------------------------------------------------
2dnsC           ----------------------------------------------------------------------
2drwD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ERSLERKIKEAFLALWLESNMSKKEILSLYLDRAYMXXXXXXXXXXXXXXXXKNLTDVTLSESAILAGLF
3dwkB           HKSIGRKAQEAYLSYRLEQEYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLP
3dwkC           HKSIGRKAQEAYLSYRLEQEYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLP
3dwkD           HKSIGRKAQEAYLSYRLEQEYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLP
2bg1A           ----------------------------------------------------------------------
2bg4A           ------------------------------------------------------ISEITYSDGTVIASI-
2bg4B           ----------------------------------------------------------------------
3dwkA           GR----KAQEAYLSYRLEQEYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLP
2c5wB           ----------------------------------------------------------------------
3d3hA           ERTLERKIKEALLAIKIERTFDKKKIMELYLNQIYLGSGAYGVEAAAQVYFGKHVWELSLDEAALLAALP
2c6wB           ----------------------------------------------------------------------
2drwE           ----------------------------------------------------------------------
3czdA           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
1e4dA           ----------------------------------------------------------------------
1bsgA           ----------------------------------------------------------------------
1e4dB           ----------------------------------------------------------------------
3e2lA           ----------------------------------------------------------------------
1ck3A           ----------------------------------------------------------------------
3cmzA           ----------------------------------------------------------------------
2b5rA           ----------------------------------------------------------------------
1e4dC           ----------------------------------------------------------------------
4blmA           ----------------------------------------------------------------------
3bffA           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
3cjmA           ----------------------------------------------------------------------
1blpA           ----------------------------------------------------------------------
3dtmA           ----------------------------------------------------------------------
1bt5A           ----------------------------------------------------------------------
1e3uD           ----------------------------------------------------------------------
3dw0A           ----------------------------------------------------------------------
1djbA           ----------------------------------------------------------------------
1dy6A           ----------------------------------------------------------------------
1e3uC           ----------------------------------------------------------------------
3bydA           ----------------------------------------------------------------------
1blcA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
3bfdA           ----------------------------------------------------------------------
3bfeA           ----------------------------------------------------------------------
3dw0B           ----------------------------------------------------------------------
1djaA           ----------------------------------------------------------------------
3e2kA           ----------------------------------------------------------------------
3c5aA           ----------------------------------------------------------------------
2dnsE           ----------------------------------------------------------------------
2cc1A           ----------------------------------------------------------------------
2bc3A           ----------------------------------------------------------------------
2bc3B           ----------------------------------------------------------------------
1bzaA           ----------------------------------------------------------------------
2bcfA           ----------------------------------------------------------------------
3brmA           ----------------------------------------------------------------------
2blsA           ----------------------------------------------------------------------
1bueA           ----------------------------------------------------------------------
2efuE           ----------------------------------------------------------------------
2e8iA           ----------------------------------------------------------------------
2bsbA           ----------------------------------------------------------------------
1dkiC           ----------------------------------------------------------------------
3by7D           ----------------------------------------------------------------------
2dnsA           ----------------------------------------------------------------------
2d0aA           ----------------------------------------------------------------------
1ci9A           ----------------------------------------------------------------------
3brmB           ----------------------------------------------------------------------
2dcfA           ----------------------------------------------------------------------
3e2lB           ----------------------------------------------------------------------
2dnsC           ----------------------------------------------------------------------
2drwD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAPAKYAPHVNLPAARARANTVLSNLVQSGLMTEGQVIGARRNPATVIDRADVKAPDYFLDWAFDEVQRL
3dwkB           QVPNNYNIYDHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKIDLKANLVNRTTNQDSEYNSYVNFVKSL
3dwkC           QVPNNYNIYDHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKIDLKANLVNIDTNQDSEYNSYVNFVKSL
3dwkD           QVPNNYNIYDHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKIDLKANLVNRTPEERQNIDTNQDVKSEL
2bg1A           --------------------------ITYDYLYFTTLAEAQERMYDYLAQRDNVSAKELKNEATQKFYRD
2bg4A           ----DYLYFTTLAEAQERMYDYL------AQRDNVSAK-------------------ELKNEATQKFYRD
2bg4B           -----------------------------------------------------------QERMYDYLANE
3dwkA           QVPNNYNIYDHPKAAEDRKNTVLYLMHYHKRITDKIDLKANLVNRTPEERQNDSEYNSYVNFVKSELMNN
2c5wB           --------------------------------------------------------PAYMDNYLKEVINQ
3d3hA           KAPAKYNPFYHPERALQRRNLVLKRMLEEGYITPEQYEEAV-----------------------------
2c6wB           --------------------------------------------------------PAYMDNYLKEVINQ
2drwE           ----------------------------------------------------------------------
3czdA           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
1e4dA           ----------------------------------------------------------------------
1bsgA           ----------------------------------------------------------------------
1e4dB           ----------------------------------------------------------------------
3e2lA           ----------------------------------------------------------------------
1ck3A           ----------------------------------------------------------------------
3cmzA           ----------------------------------------------------------------------
2b5rA           ----------------------------------------------------------------------
1e4dC           ----------------------------------------------------------------------
4blmA           ----------------------------------------------------------------------
3bffA           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
3cjmA           ----------------------------------------------------------------------
1blpA           ----------------------------------------------------------------------
3dtmA           ----------------------------------------------------------------------
1bt5A           ----------------------------------------------------------------------
1e3uD           ----------------------------------------------------------------------
3dw0A           ----------------------------------------------------------------------
1djbA           ----------------------------------------------------------------------
1dy6A           ----------------------------------------------------------------------
1e3uC           ----------------------------------------------------------------------
3bydA           ----------------------------------------------------------------------
1blcA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
3bfdA           ----------------------------------------------------------------------
3bfeA           ----------------------------------------------------------------------
3dw0B           ----------------------------------------------------------------------
1djaA           ----------------------------------------------------------------------
3e2kA           ----------------------------------------------------------------------
3c5aA           ----------------------------------------------------------------------
2dnsE           ----------------------------------------------------------------------
2cc1A           ----------------------------------------------------------------------
2bc3A           ----------------------------------------------------------------------
2bc3B           ----------------------------------------------------------------------
1bzaA           ----------------------------------------------------------------------
2bcfA           ----------------------------------------------------------------------
3brmA           ----------------------------------------------------------------------
2blsA           ----------------------------------------------------------------------
1bueA           ----------------------------------------------------------------------
2efuE           ----------------------------------------------------------------------
2e8iA           ----------------------------------------------------------------------
2bsbA           ----------------------------------------------------------------------
1dkiC           ----------------------------------------------------------------------
3by7D           -------------------NIKIRLVTGEDIIGNISESQGLITI--KKAFVIIPQG-KPVQLVLSPWQPY
2dnsA           ----------------------------------------------------------------------
2d0aA           ----------------------------------------------------------------------
1ci9A           ----------------------------------------------------------------------
3brmB           ----------------------------------------------------------------------
2dcfA           ----------------------------------------------------------------------
3e2lB           ----------------------------------------------------------------------
2dnsC           ----------------------------------------------------------------------
2drwD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AAEGKFKDHTVVVRTTIDTGLQQAAEQAMEMELREYGEGYRVKQGAMVMIENGGGVRAMVGGRDYGESQF
3dwkB           MNNKAFKDENLKIYTNMDKDVQKTLQNDVDNGSFYKNKDQ---QVGATILDSKGGLVAISGGRDFKDVVN
3dwkC           MNNKAFKDENLKIYTNMDKDVQKTLQNDVDNGSFYKNKD---QQVGATILDKTGGLVAISGGRDFKDVVN
3dwkD           MNNKAFKDENLKIYTNMDKDVQKTLQNDVDNGSFYKNKD---QQVGATILDKTGGLVAISGGRDFKDVVN
2bg1A           LAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDNQGAILGFVGGRNYQENQN
2bg4A           LAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDQTGAILGFVGGRNYQENQN
2bg4B           ATQKFYRDLAAKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDQTGAILGFVGGRNYQENQN
3dwkA           KAFKDENLGNVLQSTNMDKDVQKTLQNDVDNGSFYKNKDQQVGATILDSKTGGLVAISGGRDFKDVVNRN
2c5wB           VEEETGYNLLTDVYTNVDQEAQKHLWDIYNTDEYVAYPDDELQVASTIVDVSNGKVIAQLGARHQVSFGI
3d3hA           ----------------------------------------------------------------------
2c6wB           VEEETGYNLLTDVYTNVDQEAQKHLWDIYNTDEYVAYPDDELQVASTIVDVSNGKVIAQLGARHQVSFGI
2drwE           --------------SDLNNAIQGILDDHVA----------RGVVGVSLALCLPGEETSLYQSGYADKNKM
3czdA           --------------MSFTSHIDELYESAK----KQSGGKVADYIPQLAKFSDLWGVSVCTVDGQRH---S
1alqA           -------DKLISETAKSVMKEFAAAAKE----LNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRF-----
1e4dA           ------------------------------------------TSWNKEFSAAVNGVFVLCKSSSKSCATN
1bsgA           ---------------------------DAERRLAGLERASGARLGVYAYDTGSGRTVAYRADELF-----
1e4dB           ------------------------------------------TSWNKEFSAEANGVFVLCKSSSKSCATN
3e2lA           -------------------------------PFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERF-----
1ck3A           --------------------------PETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPE-------
3cmzA           --------------------------PETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPE-------
2b5rA           --------------------------PETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPE-------
1e4dC           ------------------------------------------TSWNKEFSAEANGVFVLCKSSSKSCATN
4blmA           -------------------------------DFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERF-----
3bffA           --------------------------QQVQKKLAALEKQSGGRLGVALINTADNSQVLYRAD--------
1e3uA           ------------------------------------------TSWNKEFSAAVNGVFVLCKSSSKSCATN
3cjmA           ------------ANTVFFDKINDLLVASVK--------EFEGTVGISYLDLETGEQRSVNGQHEF-----
1blpA           -------------------------------ELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRF-----
3dtmA           --------------------------PETLVKVKDAEDQLGARVGYIELDLNSGKILESFRSE-------
1bt5A           ---------------------------ETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER-----
1e3uD           -----------------------------------------NTSWNKEFSAAVNGVFVLCKSSSKSCATN
3dw0A           -------------------------------PFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERF-----
1djbA           -------------------------------ELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRF-----
1dy6A           ----------------KSDAAAKQIKKLEE--------DFDGRIGVFAIDTGSGNTFGYRSDERF-----
1e3uC           -----------------------------------------NTSWNKEFSAAVNGVFVLCKSSSKSCATN
3bydA           ---------------------------AIQQKLADLEKRSGGRLGVALINTADDSQTLYRGDERF-----
1blcA           -------------------------------ELNDLEKKYNAHIGVYALDTKSGKEVKFNSD--------
1e25A           ---------------------------LLKEQIESIVIGKKATVGVAVWGPDDLEPLLINPFEKF-----
3bfdA           --------------------------QQVQKKLAALEKQSGGRLGVALINTADNSQVLYRAD--------
3bfeA           --------------------------QQVQKKLAALEKQSGGRLGVALINTADNSQVLYRAD--------
3dw0B           -------------------------------PFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERF-----
1djaA           -------------------------------ELNDLEKKYNAHIGVYALDTKSGKEVKFNSDK-------
3e2kA           -------------------------------PFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERF-----
3c5aA           ---------------------------LVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERF-----
2dnsE           --------------SDLNNAIQGILDDHVARGVV----------GVSLALCLPGEETSLYQSGYADKKMP
2cc1A           ---------------------------PIDDQLAELERRDNVLIGLYAANLQSGRRITHRPDEMF-----
2bc3A           ----------------------------------------------------------------------
2bc3B           ----------------------------------------------------------------------
1bzaA           ---------------------------SVQQQLEALEKSSGGRLGVALINTADNSQILYRAD--------
2bcfA           -----------------------------------------VQPAGSVPIPDGPAQTWIVADLDSGQVLA
3brmA           -------------------------------------------------------YRPFAANGQSPDGTI
2blsA           --------------------INDIVHRTITPLIEQQKIP-----GMAVAVIYQGKPYYFTWGYADIAKKQ
1bueA           ---------------------------KGIDEIKNLETDFNGRIGVYALDTGSGKSFSYRANERF-----
2efuE           ---------------DLNNAIQGILDDHVA----------RGVVGVSLALCLPGEETSLYQSGYADKFNM
2e8iA           ---------AAVSRRPGHALARLGAIAAQLPDLEQRLEQTY---TDAFLVLRGTEVVAEYYRAGFAPDDR
2bsbA           ----------------------------------------------------------------------
1dkiC           ------------SAITFIQKIKLDKVNGGELSGSNMYVYNITGGFVIVSGDKRPEILGYSTSGSFIASFM
3by7D           TDDKEIVIDDSKVITITSDDIIKSYESHTS----------------------------------------
2dnsA           --------------SDLNNAIQGILDDHVARGVV----------GVSLALCLPGEETSLYQSGYADKFNK
2d0aA           ----------------------------------------------------------------------
1ci9A           --------------------LAARLDAVFDQALRERRLV-----GAVAIVARHGEILYRRAQGLADREAG
3brmB           ----------------------------------------------------------------------
2dcfA           ---------AAVSRRPGHALARLGAIAAQLPDLEQRLEQTY---TDAFLVLRGTEVVAEYYRAGFAPDD-
3e2lB           ----------------------------------------------------------------------
2dnsC           ----------------LNNAIQGILDDHVARGVV----------GVSLALCLPGEETSLYQSGYADKFNK
2drwD           --------------SDLNNAIQGILDDHVARGVV----------GVSLALCLPGEETSLYQSGYADKFNK


                         .         .         +         .         .         .         .:490
query           NRATAALRQPGSSFKVYTYSAAMEKGMKPDTLISDAPVTWRGWSPQNYGRSYAGKVTLQVALAKSYNTVP
3dwkB           RNQATDPHPTGSSLKPFLYGPAIENMKATNHAIQDESYQVDGSTFRNYDTKSHGTVSIYDALRQSFNIPA
3dwkC           RNQATDPHPTGSSLKPFLYGPAIENMKATNHAIQDESSYQVGSTFRNYDTKSHGTVSIYDALRQSFNIPA
3dwkD           RNQATDPHPTGSSLKPFLYGPAIENMKATNHAIQDESSYQDGSTFRNYDTKSHGTVSIYDALRQSFNIPA
2bg1A           NHAFDTKRSPASTTKPLLYGIAIDQGLGSETILSNYPTNFANNPIMYANSKGTGMMTLGEALNYSWNIPA
2bg4A           NHAFDTKRSPASTTKPLLYGIAIDQGMGSETILSNYPTNFANNPIMYANSKGTGMMTLGEALNYSWNIPA
2bg4B           NHAFDTKRSPASTTKPLLYGIAIDQGLGSETILSNYPTNFANNPIMYANSKGTGMMTLGEALNYSWNIPA
3dwkA           QATDPHPTGSSLKPFLAYGPAIENMKWATNHAIQDESSYQVDSTFRNYDTKSHGTVSIYDALRQSFNIPA
2c5wB           NQAVETNRDWGSTMKPITYAPALEYGVYEATIVHDEPYNYPGTPVYNWDRGYFGNITLQYALQQSRNVPA
3d3hA           ----------------------------------------------------------------------
2c6wB           NQAVETNRDWGSTMKPITYAPALEYGYDSTATIVHDEPYNYPTPVYNWDRGYFGNITLQYALQQSRNVPA
2drwE           PMTGDHLFRIASCTKSFIATGLHDGTVDLDEPITRWFPDLPKAAQMLNHRSGLPDFETSMPMISDKSWTA
3czdA           TGDTKVPFCLQSCVKPLKYAIAVNDLGTVHRYVGKEPSGLRLDDKPHNPMVNAGAIVVTSLIKQGVNNAE
1alqA           --------AYASTSKAINSAILLEQVPYNVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTAN
1e4dA           LARASKEYLPASTFIPNAIIGLETGVIKNEHQVFKWDGKPRA------MKQWERDLTLRGAIQVSAVPVF
1bsgA           --------PMCSVFKTLSSAAVLRDLDRGEFLSRRILYTPETGKPQNLANGMTVEELCEVSITASDNCAA
1e4dB           DLRASKEYLPASTFIPNAIIGLETGVIKNEHQVFKWDGKP------RAMKQWERDLTLRGAIQVSAVPVF
3e2lA           --------PLCSFKGFLAAAVLARSQQQADTPIRYGKNALVPISEKYLTTGMTVAELSAAAVQYSDNAAA
1ck3A           -----ERFPMMSTFKVLLCGAVLAGQEQLGRRIHYSQNDLVEVTEKHLTDGMTVRELCSAAITMSDNTAA
3cmzA           -----ERFPMMSTFKVLLCGAVLSRVDALGRRIHYSQNDLVEVTEKHLTDGMTVRELCSAAITMSDNTAA
2b5rA           -----ERFPMMSTFKVLLCGAVLSRIDALGRRIHYSQNDLVYVTEKHLTDGMTVRELCSAAITMSDNTAA
1e4dC           LARASKEYLPASTFIPNAIIGLETGVIKNEHQVFKWDGKPRA------MKQWERDLTLRGAIQVSAVPVF
4blmA           --------AFASTIKALTVGVLLQQKSIDLNQRITYTVNYNPITEKHVDTGMTLKELADASLRYSDNAAQ
3bffA           -----ERFAMCSTSKVMTAAAVLKQSGILQQKMTIKKADLTNVTEKYVGNTMTLAELSAATLQYSDNTAM
1e3uA           LARASKEYLPASTFKIPNAIIGLETGVKNEHQVFKWDGKPRA------MKQWERDLTLRGAIQVSAVPVF
3cjmA           --------YTASTIKVPLTLVADTVAKKWTDLIPYNAEEDYEIIAYNIQPEYPLKTLQEYAITYSDNIAK
1blpA           --------AYASTSKAINSAILLEQVPYKLNKKVHDIVAYSPILEKYVGKDITLKALIEASMTYSDNTAN
3dtmA           -----ERFPMMSTFKVLLCGAILSRIEQLGRRIHYSQNDLVEVTEKHLTDGMTVRELCSAAITMSDNTAA
1bt5A           -------FPMMSTFKVLLCGAVLSRIEQLGRRIHYSQNDLVEVTEKHLTDGMTVRELCSAAITMSDNTAA
1e3uD           LARASKEYLPASTFKIPNAIIGLETGVKNEHQVFKWPRAMKQWERD---------LTLRGAIQVSAVPVF
3dw0A           --------PLCSSFKGFLAAAVLARSQQLDTPIRYGKNALVPISEKYLTTGMTVAELSAAAVQYSDNAAA
1djbA           --------AYAATSKAINSAILLEQVPYKLNKKVHINVAYSPILEKYVGKDITLKALIEASMTYSDNTAN
1dy6A           --------PLCSSFKGFLAAAVLERVQQINQKVKYESRDLEYITTKYKGSGMTLGDMASAALQYSDNGAT
1e3uC           LARASKEYLPASTFKIPNAIIGLETGVKNEHQVFKWDRAMKQWER---------DLTLRGAIQVSAVPVF
3bydA           --------AMCSTGKVMAAAAVLKQSESNPEVVNKRLEIKKSITEKHLQSGMTLAELSAAALQYSDNTAM
1blcA           -----KRFAYASTSKAINSAILLEQVPYKLNKKVHDIVAYSPILEKYVGKDITLKALIEASMTYSDNTAN
1e25A           --------PMQSVFKLHLAMLVLHQVDQLNQTVIVNRAKVLQKAYQGDEFSVPVQQLLQYSVSHSDNVAC
3bfdA           -----ERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAM
3bfeA           -----ERFAMCSTSKVMTAAAVLKQSGILQQKMTIKKADLTNVTEKYVGNTMTLAELSAATLQYSDNTAM
3dw0B           --------PLCSSFKGFLAAAVLARSGLLDTPIRYGKNALVPISEKYLTTGMTVAELSAAAVQYSDNAAA
1djaA           ------RFAYASTSHAINSAILLEQVPYNVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTAN
3e2kA           --------PLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGSPISEKYLTTGMTVAELSAAAVQYSDNAAA
3c5aA           --------PLCSSFKGFLAAAVLARSGLLDTPIRYGKNALVPISEKYLTTGMTVAELSAAAVQYSDNAAA
2dnsE           MTGDH-LFRIASCTKSFIATGLHLGTVDLDEPITRWFPDLPKAAQILLNHRSGLPDFETSMPMISDKSWT
2cc1A           --------AMCSTFKGYVAARVLQMAEHGEISLDNRVFVDSPVTEARAGAEMTLAELCQAALQRSDNTAA
2bc3A           ----------------------------------------------------------------------
2bc3B           ----------------------------------------------------------------------
1bzaA           -----ERFAMCSTSKVMAAAAVLKQSESLNQRVEIKKSDLVNIAEKHVNGTMTLAELGAAALQYSDNTAM
2bcfA           GRDQNVAHPPASTIKVLLALVALDELDLNSTVVADVADTQAECVGVKPGRSYTVRQLLDGLLLVSGNDAA
3brmA           HAGDWNVSFTQSISKVISFIAACSRGIYVLDRVDVGALTIASILPGESAYEKLEFLYSVETLIGKRPRIH
2blsA           PVTQQTLFELGSVSKTFTGVLGGDAIIKLSDPTTKNGITLLGGLPLQVPDEVKSSSDLLRFYQNWYANSS
1bueA           --------PLCSSFKGFLAAAVLKGSQDNRLNLNQSLEFHSPITTKYKDNGMSLGDMAAAALQYSDNGAT
2efuE           PMTGDHLFRIASCTKSFIATGLHDGTVDLDEPITRAQMPVRPDFETSMPMISDKSWTAQEIVDFSFRHGV
2e8iA           HL-------LMSVSKSLCGTVVGEGRIDPAQPVTEYVPELAGSVYDGPISIDYNEDYVDPASEVQTHDRS
2bsbA           ----------------------------------------------------------------------
1dkiC           ESYVEQIKENKKLDSTY-AQPVVKSLLDSKGIHYNQGNPYNLEKVKPGEQSFVGQHAATGSVATATAQIM
3by7D           ----------------------------------------------------------------------
2dnsA           MPMTGDLFRIASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKAAQMPVRILLNHRSGLPDFETSMP
2d0aA           ----------------------------------------------------------------------
1ci9A           RPMRETLFRLASVTKPIVALAVLRLVLALDAPVTRWLPEFRPRLADGSEPTIHHLLTHTSGLGYWLLEGA
3brmB           ----------QSISKVISFIAACSRG--IPYVLD----RVDVEPPFNP--INAGALTIASILPGESAYEK
2dcfA           ------RHLLMAVSKSLCGTVVGAGRIDPAQPVTEAGSVYDGPSVLQVLDMQISIDYVDPASEVQTHDRS
3e2lB           -------RFPLCSFKGFLAAAVLARSQQAGRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAA
2dnsC           MPMTGHLFRIASCTKSFI-ATGLHLLVQDGTVDLDEPITRWFP-DLPKAAQMPVRILLNHRSGLPDFETS
2drwD           MPMTGHLFRIASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKAAQMPVRILLNHRSGLPDFETSMP


                         *         .         .         .         .         +         .:560
query           VRLAKDVLGTQVIVDTAKAMGVATPLRSDKTIPLGTSEVTVLDQATAYAVFPADGMQSRRHGIEQVMDYE
3dwkB           LKAWQS-VKQNAGNDAPKKFAAKLGLNYEGVLGGSASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRD
3dwkC           LKAWQS-VKQNAGNDAPKKFAAKLGLNYEGVLGGSASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRD
3dwkD           LKAWQSV-KQNAGNDAPKKFAAKLGLNYEGDIGPSEVEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRD
2bg1A           YWTYRML-RENGVDVKGYMEKMGPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2bg4A           YWTYRML-RENGVDVKGYMEKMGPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2bg4B           YWTYRMLRENGVD-VKGYMEKMGPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
3dwkA           LKAWQSV-KQNAGNDAPKKFAAKLGLNYEGDIGGSASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRD
2c5wB           VETLNKV-GLNRAKTFLNGLGIDYAISSNTTESDKKYGASSEKMAAAYAAFANGGTYYKPMYIHKVVFSD
3d3hA           ----------------------------------------------------------------------
2c6wB           VETLNKV-GLNRAKTFLNGLGISNAISSNTTESDKKYGASSEKMAAAYAAFANGGTYYKPMYIHKVVFSD
2drwE           QEIVDF-SFRHGVQKEPWHGMIFAPLGMKDTWVGTHETFPIEREARGYMHAPVDGVWDSTEWFPLSGANA
3czdA           KFDYLNKMAGNEYVGFSNATFQSERESGDYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATL
1alqA           NKIIKEIGGIKKVKQRLKELGDKTNPVRYEIELNYYSTSTPAAFGKTLNKLIANGKLSKENKKFLLDLML
1e4dA           QQIAREVGE-VRMQKYLKKFSYGNQNISGKFWLEGQLRISAVNQVEFLESLYLNKLSASKENQLIVKEAL
1bsgA           NLMLRELGGPAAVTRFVRSLGDWEPELNSAEPGRVTDTTSPRAITRTYGRLVLGDALNPRDRRLLTSWLL
1e4dB           QQIAREV-GEVRMQKYLKKFSYGNQNIIDKFWLEGQLRISAVNQVEFLESLYLNKLSASKENQLIVKEAL
3e2lA           NLLLKELGGPAGLTAFMRSIGDWELELNSAIPSDARDTSSPRAVTESLQKLTLGSALAAPQ---------
1ck3A           NLLLTTIGGPKELTAFLHNMGDVTRLDRWEPELNEAIPNDERDTTMPVAMATT---------LRKLLTGE
3cmzA           NLLLTTIGGPKELTAFLHNMGDHVTELNEAIPNDERDTTMPAAMATTLRKLLTGE---------------
2b5rA           NLLLTTIGGPKELTAFLHNMGDVTRLDRWEPELNEAIPNDERDTTMPAAMATT---------LRKLLTGE
1e4dC           QQIARE-VGEVRMQKYLKKFSYGNQNIIDKFWLEGQLRISAVNQVEFLESLYLNKLSASKENQLIVKEAL
4blmA           NLILKQIGGPESLKKELRKIGDFEPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMK
3bffA           NKLLAHLGGPGNVTAFARSIGDTFRLDRKEPELNTAITTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLK
1e3uA           QQIAREV-GEVRMQKYLKKFSYGNQNISGKFWLEGQLRISAVNQVEFLESLYLNKLSASKENQLIVKE--
3cjmA           NLYDTLG-GDAKAKREYQRYLHKTPS-------IEEPQFSSEDALVILQKLYTEKATKPDYQAIYDSKQS
1blpA           NKIIKEIGGIKKVKQRLKELGDKVTNPVRYSPKSKKNTSTPAAFGKTLNKLIANGKLSKENKKFLLDLML
3dtmA           NLLLTTIGGPKGLTAFLHNMGDHVTRLDRWEPNDERDTTTPVAMATTLRKLLTGELLTPASRQ-------
1bt5A           NLLLTTIGGPKELTAFLHNMGDVTRLDRWEPELNEAIPNDERDTTMPVAMATT---------LRKLLTGE
1e3uD           QQIAREV-GEVRMQKYLKKFSYGNQNISGKFWLEGQLRISAVNQVEFLESLYLNKLSASKENQLIVKE--
3dw0A           NLLLKELGGPAGLTAFMRSIGDTFRLDRWELELNSAIPGDARDTSSPRAVTES-----------------
1djbA           NKIIKEIGGIKKVKQRLKELGDKTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGK--------
1dy6A           NIIMERFLGPEGMTKFMRSIG------------DNEFRLDRWELELNTAIPGDKRDTSTPKAVANSLNKL
1e3uC           QQIARE-VGEVRMQKYLKKFSYGNQNIIDKFWLEGQLRISAVNQVEFLESLYLNKLSASKENQLIVKE--
3bydA           NKMISYLGGPEKVTAFAQSIGDVFRLDRTEPALNSAITTTPLAMAESLRKLTLGNALGEQQRAQLVTWLK
1blcA           NKIIKEIGGIKKVKQRLKELGDKVTELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKF------
1e25A           DLLFELVGGPAALHDYIQSMGIETAVVANEAQMHADDWTSMKGAAEILKKFEQKTQLSETSQALLWKWMV
3bfdA           NKLLAHLGGPGNVTAFARSIGTTFRLDRKEPELDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLK
3bfeA           NKLLAHLGGPGNVTAFARSIDTTFRLDRKEPELNTAITTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLK
3dw0B           NLLLKELGGPAGLTAFMRSIGDTTFELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQ---------
1djaA           NKIIKEIGGIKKVKQRLKELGDKVIELNYYSPKSKKDTSTPAAFGKTLNKLIANG---------------
3e2kA           NLLLKELGGPAGLTAFMRSIGDTFRLDRWELELNSAITSSPRAVTESLQKLTLGS---------------
3c5aA           NLLLKELGGPAGLTAFMRSIGDTFRLDRWELELNSAITSSPRAVTESLQKLTLGS---------------
2dnsE           AQEIVDFSFRHGVQKEPWHGMIFAPLGMKDTWVGTHETFPIEREARGYMHAWDSGAGDPVDGVWDSTEWF
2cc1A           NLLLKTIGGPAAVTAFARSVGDRTRLDRWEVELNSAIPGDPRDTSTPAALA--------VGYRAILAG--
2bc3A           ---------------------------------------------------------------------G
2bc3B           ----------------------------------------------------------------------
1bzaA           NKLIAHLGGPDKVTAFARSLGDTFRLDRTAPTLNTAITTTPLAMAQTLKNLTLGKALAETQRAQLVTWLK
2bcfA           NTLA-HLGGQDVTVAKNAKAATLGATSTHADGPGGSGASTAHDLVVIFRAA-ANPVFAQIIAEPSAFPSD
3brmA           EEVFRS-----EWETAHRNRALAYYLKETNFLEKQCAESTTEDIALIGLILAHDGYH-------------
2blsA           IGLFGALAVTWINVPPAEEKNYAWGYREGKAVHVYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQ
1bueA           NIILERYIGPEGMTKFMRSIGD--------------------EDFRLDRWELDLNTAIPGDERDTSTPAA
2efuE           QKEPWHGMSNTGYVLAGMIIAHETGLRSRIFAPLGMKDTWVGTHETFPIEREARGYMHAGVWDSTEWFPL
2e8iA           AGWRTRRHGDPADTYEFLTTLRGDGSTGEFQYCVERVTGLRYVEALSTYLWAKLDADRDATITVDTTGFG
2bsbA           ----------------------------------------------------------------------
1dkiC           KYHNYPN---------------------------------------------------------------
3by7D           ----------------------------------------------------------------------
2dnsA           MISD-KSWTAQEIVDFSFRHGVQKE---------------------------------------------
2d0aA           ----------------------------------------------------------------------
1ci9A           GSVYDRLGISDFDLDENLRRLASAPLSFAPGSGWQYSLALDVLGAVVERATGQPLAAAVDALVAQPLGMR
3brmB           LEFLYSVIGKRPRIHEEVFRALAYYLKETNFLEAECAESTTEDIALIGLILAHDGYHPIRH---------
2dcfA           AGWRTRRHGDADTYEFLTTLRGDGSTGEFQYCSANTDVLAWIVELSTYLWAKLDADRDATITVDTTGFGF
3e2lB           NLLLKELGGPAGLTAFMRSIGDTT-FRLDRWELELNSAIDARDTSSPRAV--TESLQKLTLG--------
2dnsC           MPMISDKSWT------------------------------------------------------------
2drwD           MISDKSW---------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GNVLYDFSHDEPPAKRVLSEEANSKMNQMLVTIPVMGTARRGALDNGIVSGGKTGTSQAYRDAWYVGFTG
3dwkB           GETIEYD----HTSHKAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGVNMGAKTGTGTAAKDVWINGFTP
3dwkC           GETIEYD----HTSHKAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGVNMGAKTGTGTAAKDVWINGFTP
3dwkD           GETIEYD----HTSHKAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGVNMGAKTGTGTAAKDVWINGFTP
2bg1A           GRVVYEY---QDKPVQVYSKATATIMQGLLREVLSSRVTSLNPTLANADWIGKTGTTNQDENMWLMLSTP
2bg4A           GRVVYEY---QDKPVQVYSKATATIMQGLLREVLSSRVTTTNPTLANADWIGKTGTTNQDENMWLMLSTP
2bg4B           GRVVYEY---QDKPVQVYSKATATIMQGLLREVLSSRVTTTNPTLANADWIGKTGTTNQDENMWLMLSTP
3dwkA           GETIEYD----HTSHKAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGVNMGAKTGTGTAAKDVWINGFTP
2c5wB           GSEKEFS----NVGTRAMKETTAYMMTDMMKTVLTYGTGRN-AYLAWLPQAGKTGTSNVAPDELFAGYTR
3d3hA           ----------------------------------------------------------------------
2c6wB           GSEKEFS----NVGTRAMKETTAYMMTDMMKTVLTYGTGRNAYLA-WLPQAGKTGTSNVAPDELFAGYTR
2drwE           AGDMVSTPRDALFDGRILDQKRLWEMKDNIKPAFFPGSNTVAMRYGSSELKGHLGQIPGHTSIMGRDEET
3czdA           ANGGF----CPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGL--PAKSGVAG-----GILLVVN
1alqA           NNKSGD------------------------------TLIKDGVPKDYKV-ADKSGQAITYASRNDVAFV-
1e4dA           VTE-----------------------------------AAPEYLVHSKTGFSGVGTESNPGVAWWVGWVE
1bsgA           ANTTSG------------------------------DRFRAGLPDDWTL-GDKTGAGRYNNDAGVTWPPG
1e4dB           VTEAAP-----------------------------------EYLVHSKTGFSGVGTESNPGVAWWVGWTE
3e2lA           ----------------------RQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVW
1ck3A           ----------------LLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERRGIIAALGPDG
3cmzA           ----------------LLTPASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERRGIIAALGPDG
2b5rA           ----------------LLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERRGIIAALGPDG
1e4dC           VTEAAP------------------------------EYLVHSK-----TGFSGVGTESNPGVAWWVGWTE
4blmA           RNT-------------------------------TGDALIRAGVPDGWEVADKTGAASTRNDIAIIWPPK
3bffA           GNTTGG------------------------------QSIRAGLPAHWVV-GDKTGACDYTNDIAVIWPED
1e3uA           -------------------------ALVTEAAPEYLVHSKTGF--------SGVGTESNPGVAWWVGWTE
3cjmA           VFHE------------------------------------RETPTTQGKVAHKIGSYDEFIHDGILETPH
1blpA           NN-------------------------------KSGDTLIKDGVPKDYKVADKSGQAITYASVYPKGQSE
3dtmA           ------------------------QLMDWMEADKVAGPLLRSVLPAGWFIADKSGAGERRGIVAALGPDG
1bt5A           ----------------LLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERRGIIAALGPDG
1e3uD           -------------------------ALVTEAAPEYLVHSKTGF--------SGVGTESNPGVAWWVGWTE
3dw0A           --------LQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVRA
1djbA           -----------------LSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYRNDVAFVYPE
1dy6A           AL------------GNVLNAKVKAIYQNWLKGNTTGDARIRASVPADWVVGDKTGSCGAYGTANDYAVIW
1e3uC           ----------------------------ALVTEAAPEYLVHSKTGF-----SGVGTESNPGVAWWVGWTE
3bydA           GNTTG-------------------------------GQSIRAGLPASWAVGDKTGAGDYGNDIAVIWPEN
1blcA           -------------------------LLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYRNDVAFVYPE
1e25A           ETTTG---------------------PERLKGLLPAGTVVAHKTGTSQIKAGKTAATNDLGIILLPD-GR
3bfdA           GNTTGG------------------------------QSIRAGLPAHW-VVGDKTGACDTTNDIAVIWPED
3bfeA           GNTTGG------------------------------QSIRAGLPAHWVV-GDKTGAGDYTNDIAVIWPED
3dw0B           ----------------------RQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVW
1djaA           ----------------KLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITSRNDVAFVYSE
3e2kA           ----------------ALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVRA
3c5aA           ----------------ALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVW
2dnsE           PLSGANAAGDMVSTPRDIVKFLNALFDGRILDDNIKPAFFPGSNTVANGHGLLLMRYGSSELKGHLGQIP
2cc1A           ---------------DALSPPQRGLLEDWMRA--NQTSSMRAGLPEGWTTADKTGSGDYTNDAGIAFGPD
2bc3A           ITGTWYN---QLGSTFIVTAGADGALTGTYESGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRN
2bc3B           ITGTWYN---QLGSTFIVTAGADGALTGTYESNAESRYVLTGRYD-SAPATDGSGTALGWTVAWKNNYRN
1bzaA           GNTTG-------------------------------SASIRAGLPKSWVVGDKTGSGDYTNDIAVIWPEN
2bcfA           EQLIV-------------------------------NQDELLQRYPGAIGGTGYTNAARKTFVGAAARGG
3brmA           ----------PIRHEQVIPKDV-AKLAKALLTCGYNASGKYAAFVG---VPAKSGVSG-----GIALVPP
2blsA           SRYWQ------TGDMYQGLGWEMLDWPVNPDSIINGSDNKIALAARPV--KAITPPTPAVRASWVTGATG
1bueA           VAKSLKTLALGNI----LSEHEKETYQTWLKGNTTGAARIRASVPSDWVVGDKTGSCGAYGTANDYAVVW
2efuE           SGANAAGDMVSTPDGRILDQKRLWEMKDNIKPAFFNGHGLLLMRYGSSELKGHLGQIPGHTSIMGRDEET
2e8iA           FAHGGVSCTARDLARPGGRVVSEDWVRRVLAGGSHEAMTDKGFTNTFPDGSYTRQWWCTGNERGNVSGIG
2bsbA           ----------------------------SFIGSTENDVGPSQGSYSLPF-VYDTGYNIGYQNANVWHISG
1dkiC           ----------------------------------------------------------------------
3by7D           ----------------------------------------------------------------------
2dnsA           ----------------------------------------------------------------------
2d0aA           -------------YVIQADQQLLDALRAHYEGALPAGALFAVKRPDVVITAYRSGKVLKAAEQEAAKWIS
1ci9A           DCGFV-----------------------------------------------------------------
3brmB           --------------EQVIPKDV-AKLAKALLTCGYNASGKY-AAFVGV--PAKSGVSGGI----------
2dcfA           ANDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHEAMTDKGFTFPDGSYTRQWWCTGNERGNVSGIG
3e2lB           ---------------SALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGDYAVVWPTG
2dnsC           ----------------------------------------------------------------------
2drwD           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           NYTTAVWFGNDEFTPMNNMTGGALPAMTYKRLMDYAHQGMELRPIPGIQNLLPxxxxxxxxxxxxxxxxx
3dwkB           QYTMSVWMGFSKVKQYGGHSQQEYPQFLYENVMSKISSRDGEDFKR------------------------
3dwkC           QYTMSVWMGFSKVKQYGENSQQEYPQFLYENVMSKISSRDGEDFKR------------------------
3dwkD           QYTMSVWMGFSKVKQYVGHSQQEYPQFLYENVMSKISSRDGEDFKR------------------------
2bg1A           RLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGN------------------------
2bg4A           RLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGN------------------------
2bg4B           RLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGN------------------------
3dwkA           QYTMSVWMGFSKVKQYVGHSQQEYPQFLYENVMSKISSRDGEDFKR------------------------
2c5wB           KYSMAVWTGYSNRLTPLVGNGLTVAAKVYRSMMTYLSEGSNPEDWN------------------------
3d3hA           ----------------------------------------------------------------------
2c6wB           KYSMAVWTGYSNRLTPLVGNGLTVAAKVYRSMMTYLSEGSNPEDWN------------------------
2drwE           GAALMLIQNSGAGDFESFYLKGVNEPV--DRVLEAIKN--------------------------------
3czdA           VMGMMCWSPPL------DKMGNSVKGIHFCHDLVSLCNFH------------------------------
1alqA           ----------------------------------------------------------------------
1e4dA           VYFFAFNMDID------NESKLPLRKSIPTKIMES-----------------------------------
1bsgA           RIVLTVLTAKTEQDA---ARDDGLVADAARVLAET-----------------------------------
1e4dB           VYFFAFNMDID------NESKLPLRKSIPTKIMES-----------------------------------
3e2lA           PIVLAVYTRAPNKDDKHS----------------------------------------------------
1ck3A           KPSRIVVIYTTGSQA-TMDERDRQIAEIGASLIKH-----------------------------------
3cmzA           KPSRIVVIYTTGSQA-TMDERNRQIAEIGASLIKH-----------------------------------
2b5rA           KPSRIVVIYTTGSQA-TMDERNRQIAEIGASLIKH-----------------------------------
1e4dC           VYFFAFNMDID------NESKLPLRKSIPTKIMESE----------------------------------
4blmA           GVVLAVLSSRDKKDA---KYDDKLIAEATKVVMKA-----------------------------------
3bffA           RAPLVLVTYFTQPQQDAK-WRKDVLAAAAKIVTE------------------------------------
1e3uA           VYFFAFNMDID------NESKLPLRKSIPTKIMES-----------------------------------
3cjmA           PFALAIFTKGPDNAK-SAAFIASVTDKLWQLQV-------------------------------------
1blpA           PIVLVIFTNKDN---KSDKPNDKLISETAKSVMKE-----------------------------------
3dtmA           KPSRIVVIYTTGSQA-TMDELNRQIAEIGASLIKH-----------------------------------
1bt5A           KPSRIVVIYTTGSQA-TMDERNRQIAEIGASLIKH-----------------------------------
1e3uD           VYFFAFNMDID------NESKLPLRKSIPTKIMES-----------------------------------
3dw0A           PIVLAVYTRAPNKDDKHS----------------------------------------------------
1djbA           PIVLVIFTNKDN---KSDKPNDKLISETAKSVMKE-----------------------------------
1dy6A           PLIVSIYTTRKSKDD---KHSDKTIAEASRIAIQA-----------------------------------
1e3uC           VYFFAFNMDID------NESKLPLRKSIPTKIMESE----------------------------------
3bydA           HAPLVLVTYFTQPQQDAK-SRKEVLAAAAKIVTEG-----------------------------------
1blcA           PIVLVIFTNKDN---KSDKPNDKLISETAKSVMKE-----------------------------------
1e25A           PLLVAVFVKDSAESS---RTNEAIIAQVAQTAYQFELKKLS-----------------------------
3bfdA           RAPLVLVTYFTQPQQD-AKWRKDVLAAAAKIVTE------------------------------------
3bfeA           RAPLVLVTYFTQPQQ-DAKWRKDVLAAAAKIVTEG-----------------------------------
3dw0B           PIVLAVYTRAPNKDDKHS----------------------------------------------------
1djaA           PIVLVIFTNKDN---KSDKPNDKLISETAKSVMKE-----------------------------------
3e2kA           PIVLAVYTRAPNKDDKHS----------------------------------------------------
3c5aA           PIVLAVYTRAPNKDDKHS----------------------------------------------------
2dnsE           GHTSIMGRDEETIQNSGAGDFESFYLKGVNEPVDRVLEAIK-----------------------------
2cc1A           GLLLVMMTRSQAHDPKAE-NLRPLIGELTALVLPSL----------------------------------
2bc3A           AHSATTWSGQYVGGAQWLLTSGTTEANAWKSTLVGHDTFTKVKP--------------------------
2bc3B           AHSATTWSGQYVGGAQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAK-----------------
1bzaA           HAPLVLVTYFTQPEQKAE-RRRDILAAAAK----------------------------------------
2bcfA           RRLVIAYGLVKE-------GGPTYWDQA-ATLFDWGFALNPQASVG------------------------
3brmA           SQPFQSGCGIGIYGPAIDEYGNSLTGGLLKHAQEW-----------------------------------
2blsA           GFGSYVAFIPEKVMLANKNYPNPARVDAAWQILN------------------------------------
1bueA           PLIISVYTTKNEKEA---KHEDKVIAEASRIAIDN-----------------------------------
2efuE           GAALMLIQNSGAGDFES-----------------------------------------------------
2e8iA           IHGQNLWL--------------------------------------------------------------
2bsbA           GFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWE-----------------
1dkiC           ----------------------------------------------------------------------
3by7D           ----------------------------------------------------------------------
2dnsA           ----------------------------------------------------------------------
2d0aA           GASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFG-------------------------------
1ci9A           ----------------------------------------------------------------------
3brmB           ----------------------------------------------------------------------
2dcfA           IHGQNLWL--------------------------------------------------------------
3e2lB           RIVLAVYTRAPNKDDKHS----------------------------------------------------
2dnsC           ----------------------------------------------------------------------
2drwD           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dwkB           ---------------------------------------------------------
3dwkC           ---------------------------------------------------------
3dwkD           ---------------------------------------------------------
2bg1A           ---------------------------------------------------------
2bg4A           ---------------------------------------------------------
2bg4B           ---------------------------------------------------------
3dwkA           ---------------------------------------------------------
2c5wB           ---------------------------------------------------------
3d3hA           ---------------------------------------------------------
2c6wB           ---------------------------------------------------------
2drwE           ---------------------------------------------------------
3czdA           ---------------------------------------------------------
1alqA           ---------------------------------------------------------
1e4dA           ---------------------------------------------------------
1bsgA           ---------------------------------------------------------
1e4dB           ---------------------------------------------------------
3e2lA           ---------------------------------------------------------
1ck3A           ---------------------------------------------------------
3cmzA           ---------------------------------------------------------
2b5rA           ---------------------------------------------------------
1e4dC           ---------------------------------------------------------
4blmA           ---------------------------------------------------------
3bffA           ---------------------------------------------------------
1e3uA           ---------------------------------------------------------
3cjmA           ---------------------------------------------------------
1blpA           ---------------------------------------------------------
3dtmA           ---------------------------------------------------------
1bt5A           ---------------------------------------------------------
1e3uD           ---------------------------------------------------------
3dw0A           ---------------------------------------------------------
1djbA           ---------------------------------------------------------
1dy6A           ---------------------------------------------------------
1e3uC           ---------------------------------------------------------
3bydA           ---------------------------------------------------------
1blcA           ---------------------------------------------------------
1e25A           ---------------------------------------------------------
3bfdA           ---------------------------------------------------------
3bfeA           ---------------------------------------------------------
3dw0B           ---------------------------------------------------------
1djaA           ---------------------------------------------------------
3e2kA           ---------------------------------------------------------
3c5aA           ---------------------------------------------------------
2dnsE           ---------------------------------------------------------
2cc1A           ---------------------------------------------------------
2bc3A           ---------------------------------------------------------
2bc3B           ---------------------------------------------------------
1bzaA           ---------------------------------------------------------
2bcfA           ---------------------------------------------------------
3brmA           ---------------------------------------------------------
2blsA           ---------------------------------------------------------
1bueA           ---------------------------------------------------------
2efuE           ---------------------------------------------------------
2e8iA           ---------------------------------------------------------
2bsbA           ---------------------------------------------------------
1dkiC           ---------------------------------------------------------
3by7D           ---------------------------------------------------------
2dnsA           ---------------------------------------------------------
2d0aA           ---------------------------------------------------------
1ci9A           ---------------------------------------------------------
3brmB           ---------------------------------------------------------
2dcfA           ---------------------------------------------------------
3e2lB           ---------------------------------------------------------
2dnsC           ---------------------------------------------------------
2drwD           ---------------------------------------------------------