[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK86987.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "3e3jC.bssp"
#ERROR : Can't open dsspfile "3dkbA.bssp"
#ERROR : Can't open dsspfile "1cezA.bssp"
#ERROR : Can't open dsspfile "3e2eA.bssp"

## Summary of PDB Search
:863
    e-116  34%  1aroP  [e.8.1] T7 RNA POLYMERASE
    9e-95  36%  3e3jC  [x.x.x] DNA-DIRECTED RNA POLYMERASE
    2e-35  15%  3dkbA  [x.x.x] TUMOR NECROSIS FACTOR, ALPHA-INDUCED PROTEIN 3
    1e-32  32%  1cezA  [e.8.1] PROTEIN (BACTERIOPHAGE T7 RNA POLYMERASE)
    8e-14  29%  3e2eA  [x.x.x] DNA-DIRECTED RNA POLYMERASE
:863

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIELDTTNELFLAAHGCLPTEHEAWEKQIALEEEMRSAGIARFEKGLEKNREKNAEASNLSSRRMIIHAH
1aroP           ----------------------------------------------------------------------
3e3jC           ---------------------------QLALEHESYEMGEARFRK-----------------MFLITTLL
3dkbA           ----------------------------------------------------------------------
1cezA           -IAKNDFSDIELAAIPFDHYGERLAREQLALEHES-------YEMGEARFRKMFPLITTLLPK-----MI
3e2eA           ----------------------RLAREQLALEHESY----EMGEARFRKMFERLITTLLPKMIARINDWF


                         .         .         *         .         .         .         .:140
query           AQVIAGLEAFLAEASSGKAGKKHTAVAYLKDADLDVVAHLTLRNLFDYVSMRMKLTPLSIRLAAMVEDEL
1aroP           ----------------------------------------------------------------------
3e3jC           PKMIARINDWFEEVKA-KRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSNTTVQAVASAIGRAIEDEA
3dkbA           ----------------------------------------------------------------------
1cezA           ARINDWFEEVKAKR-----GKRPTAFQFLQEIKPEAVAYITIKTTLACLTSATTVQAVASAIGRAIEDEA
3e2eA           EEV------------KAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSNTTVQAVASAIGRAIEDEA


                         +         .         .         .         .         *         .:210
query           FFNAFKGHDKDAYEYARKKISEQTHNAVHQKRAMTKHAKHKGAEWQDWSQDVKAKVGLKLIEIAVEQTGL
1aroP           ----------------------------------------------------------------------
3e3jC           RFGRIRDLEAKHFKKNVKAFMQ------VVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIESTGM
3dkbA           ------GVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQETRNWNDEWDNLIKMASTDTPMARSGL
1cezA           RFGRIRDLEAKHFQLKRVGHVYKKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEMLIESTGM
3e2eA           RFGRIRDL-EAKHFKKNVYKKAFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRCIEML---IESTGM


                         .         .         .         +         .         .         .:280
query           FEIVRQSEGAHNTNIYVVATKETLDWLATENSRLAPLSPVYLPTLVPPRPWTSPFRGGYWSGRVRNLRLI
1aroP           --------------------------------AWSSWHKEDSIHVGVRCIEMLIESTGMVSLHRQNSETI
3e3jC           VSLHRQNAGV------VGQDSETIELAPEYAEAIAGISLMFQPCVVPPKPWTGITGGGYWANGRRPLALV
3dkbA           LEEIHIFVLCNILRRPIIVISDK--MLRSLESGPLKVGGIYLPLHWPAQECYYPIVLGYDSHHFVPLVTL
1cezA           VSLHRQNAGVVGQDSETIELAPEYAAIATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALV
3e2eA           VSLHRQNAG-------VVGQDSETIELAPEY-AEAIISLMFQPCVVPPKPWTGITGGGYWANGRRPLALV


                         .         *         .         .         .         .         +:350
query           KTGNRQYLMDLESVDMPKVYHSINAMQNTAWSINHRVYEVMASLWDNQSTLACIPQADDMPLPEKPMWLA
1aroP           ELAPEYAEAIAT--RAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALVRTHSKKALMRYEDVY
3e3jC           RTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVANVITKWKHCPVDIPAIEREELPMKP----
3dkbA           KDSGAVPLVNRDRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPWDHGTTHLINAALDEANLPKEI----
1cezA           RTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVANVITKWKHCPVEDIPAIEREELPMKPEDI
3e2eA           RTHSKKALMRYEDVYMPEVYKAINIAQNTAWKINKKVLAVANVITKWKHCPVEDI-----PAIEREELPM


                         .         .         .         .         *         .         .:420
query           PEMKREDMSPEQLEEFSRWKSERTTIYEANARAVSKRLAFSRMLGVATRFKDEEEFYFPHQMDFRGRVYA
1aroP           MPEVYKAINIWKINKKVLAVANVITKWVYRKDKARKSRRISFMLEQANKFANHKAIWFPYNMDWRGRVYA
3e3jC           ---EDIDMNP---EALTAWKRAAAAVYRKDKARKSRRISLEFMLEQANKFANHKAIWFPYNMDWRGRVYA
3dkbA           --NLVDDYFELVQHEYKKWQENS-----------------------------------------------
1cezA           DMNPE---------ALTAWKRAAAAVYRKDKARKSRRISLEFMLEQANKFANHKAIWFPYNMDWRGRVYA
3e2eA           KPDMNPEALTAWKRAAAAVYRKDKARK---------SRRISLEFMLEQANKFANHKAIWFPYNMDWRGRV


                         .         .         +         .         .         .         .:490
query           VPLFLNPQGDDASHGLLQFANSVPITNEEGADWLAIHGAGLWGVDKCSMNERVEWVMANQREILASAENP
1aroP           VS-MFNPQGNDMTKGLLTLAKGKPI-GKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSP
3e3jC           VS-MFNPQGNDMTKGLLTLAKGKP-IGKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSP
3dkbA           ----------------------------------------------------------------------
1cezA           VS-MFNPQGNDMTKGLLTLAKGKP-IGKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSP
3e2eA           YAVSMFNPQGNDMTKGLLTLAKGKPIGKEGYYWLKIHGANCAGVDKVPFPERIKFIEENHENIMACAKSP


                         *         .         .         .         .         +         .:560
query           YDNRFWLTAEKPWQALAFCFEWQGYVAEGFAFHSHLPVQMDGTCNGLQNFSAMLLDEIGGAAVNLVPSDK
1aroP           LENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSET
3e3jC           LENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSET
3dkbA           ----------------------------------------------------------------------
1cezA           LENTWWAEQDSPFCFLAFCF--------------------------------------------------
3e2eA           LENTWWAEQDSPFCFLAFCFEYAGVQHHGLSYNCSLPLAFDGSCSGIQHFSAMLRDEVGGRAVNLLPSET


                         .         .         .         *         .         .         .:630
query           PNDIYATVASVLIAKLRDIAAACPXXXXXXXXXXXXXXXXXXIVVESDGSMARKWLAYGITRKVTKRPVM
1aroP           VQDIYGIVAKKVNEILQADAINGG-----------------------TKALAGQWLAYGVTRSVTKRSVM
3e3jC           VQDIYGIVAKKVNEILQADA------------INGTDNEVVTVTISEKVKLGTKALAYGVTRSVTKRSVM
3dkbA           ----------------------------------------------------------------------
1cezA           ----------------------------------------------------------------------
3e2eA           VQDIYGIV--------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           TLAYGASEFGFREQVFTDTVTPWKQAAGEAFPFEGTGFAAASFLGLLIWDCXXXXXXXXXXXMDWLQKVA
1aroP           TLAYGSKEFGFRQQVLEDTIQP-AIDSGKGLMFTQP-NQAAGYMAKLIWESVSVTVVAAVEAMNWLKSAA
3e3jC           TLAYGSKEFGFRQQVLEDT--------IQPAIDSGKGNQAAGYMAKLIWESVSVTVVAAVEAMNWLKSAA
3dkbA           ----------------------------------------------------------------------
1cezA           ----------------------------------------------------------------------
3e2eA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           KIAAKESLPVIWNTPAGLKVMQEYTTSEQKRLELTFQKVRLQLSIDVASKKIDKRKQGSGISPNWVHSMD
1aroP           KLLAAEVSAVHWVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKEIDAHKQESGIAPNFVHSQD
3e3jC           KLLAAEVCAVHWVTPDGFPVWQEYPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHSQD
3dkbA           ----------------------------------------------------------------------
1cezA           ----------HWVTPDGFPVWQEYKKPIQTRLNLMFLGQFQPTINTNKDSEIDAHKQESGIAPNFVHSQD
3e2eA           ------------------------------------------------------------IAPNFVHSQD


                         .         .         *         .         .         .         .:840
query           AAHMQLTVSRCHDEGIRSFSLIHDSYGTHAGNAWAMAQFLREEFVKMYGDHDVLAEFGREITAMLPEGTQ
1aroP           GSHLRKTVVWAHEKYIESFALIHDSFGTIPADAANLFKAVRETMVDTYESSDVLADFYDQFADQLHESQL
3e3jC           GSHLRKTVVWAHEYGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESADFYDQFADQL--HESQLDK
3dkbA           ----------------------------------------------------------------------
1cezA           GSHLRKTVVWAHEKYIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLHESQK
3e2eA           GSHLRKTVVWAHEKGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLADFYDQFADQLSQLDK


                         +         .         .         .         .         *         .:910
query           LPPLPEKGSLDLSQVLESAFFFA
1aroP           MPALPAKGNLNLRDILES-----
3e3jC           MPALPAKGNLNLRDILESDFAFA
3dkbA           -----------------------
1cezA           MPALPAKGNLNLRDILESDFAFA
3e2eA           MPALPAKGNLNLRDILESDFAFA