[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK87067.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3curH.bssp"
#ERROR : Can't open dsspfile "3cusQ.bssp"
#ERROR : Can't open dsspfile "1cc1L.bssp"
#ERROR : Can't open dsspfile "1e3dB.bssp"
#ERROR : Can't open dsspfile "3cusR.bssp"
#ERROR : Can't open dsspfile "3d7aA.bssp"
#ERROR : Can't open dsspfile "2bshA.bssp"
#ERROR : Can't open dsspfile "2bsjA.bssp"
#ERROR : Can't open dsspfile "2bshB.bssp"
#ERROR : Can't open dsspfile "2bsiA.bssp"
#ERROR : Can't open dsspfile "2bhoA.bssp"
#ERROR : Can't open dsspfile "2dqbD.bssp"

## Summary of PDB Search
:396
    e-102  17%  3curH  [x.x.x] PERIPLASMIC [NIFE] HYDROGENASE LARGE SUBUNIT
    e-101  15%  3cusQ  [x.x.x] PERIPLASMIC [NIFE] HYDROGENASE LARGE SUBUNIT
    2e-90  16%  1cc1L  [e.18.1] HYDROGENASE (LARGE SUBUNIT)
    4e-90  11%  1e3dB  [e.18.1] [NIFE] HYDROGENASE LARGE SUBUNIT
    1e-72  13%  3cusR  [x.x.x] PERIPLASMIC [NIFE] HYDROGENASE LARGE SUBUNIT
    9e-31  11%  3d7aA  [x.x.x] UPF0201 PROTEIN PH1010
    1e-22  12%  2bshA  [x.x.x] SYCT
    6e-21  12%  2bsjA  [x.x.x] CHAPERONE PROTEIN SYCT
    3e-18   8%  2bshB  [x.x.x] SYCT
    7e-16   7%  2bsiA  [x.x.x] YOPT CHAPERONE SYCT
    1e-10   9%  2bhoA  [x.x.x] CHAPERONE PROTEIN SYCT
    3e-10  11%  2dqbD  [x.x.x] DEOXYGUANOSINETRIPHOSPHATE TRIPHOSPHOHYDROLASE,
:396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xTEHNVRNFTINFGPEHPSAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDY
3curH           -TPQSTFTGPIVVDPITR-IEGHLRIMVEVENGKVKDAWSS-SQLFRGLEIILKGRDPRDAQHFTQRACG
3cusQ           -TPQSTFTGPIVVDPITR-IEGHLRIMVEVENGKVKDAWSS-SQLFRGLEIILKGRDPRDAQHFTQRACG
1cc1L           ---------KISIDPLTR-VEGHLKIEVEVKDGKVVDAKCS-GGMFRGFEQILRGRDPRDSSQIVQRICG
1e3dB           ------------TEEFAAVQAKLKTFVASGQLGPFTNAYFLGGHEMDPEANLVCTAHYLQALRAQVEVAK
3cusR           -TPQSTFTGPIVVDPITR-IEGHLRIMVEVENGKVKDAWSS-SQLFRGLEIILKGRDPRDAQHFTQRACG
3d7aA           ----------------------------------------------------------------------
2bshA           ----------------------------------------------------------------------
2bsjA           ----------------------------------------------------------------------
2bshB           ----------------------------------------------------------------------
2bsiA           ----------------------------------------------------------------------
2bhoA           ----------------------------------------------------------------------
2dqbD           ------------------------KARDTRGRAHPEPESLYRTPYQKDRDRILHT-TAFRRLEYKTQVLP


                         .         .         *         .         .         .         .:140
query           VAPMNQEHAFALAVEKLLGLEIPMRGQLIRVLYSEIGRILSHIMNVTTQAMDVGAMTPPVWGFEEREKLM
3curH           MCTYVHALASSRCVDDAVKVSIPANARMMRNLVMASQYLHDHLVHFYHMALDWVDVTAALKAKAVQDKLK
3cusQ           ICTYVHALASSRCVDDAVKVSIPANARMMRNLVMASQYLHDHLVHFYHHALDWVDVTAALKAKAVQDKLK
1cc1L           VCPTAHCTASVMAQDDAFGVKVTTNGRITRNLIFGANYLQSHILHFYHLAANTYGLNQYLKALEIRRICH
1e3dB           GMAVPHTQFTVAGGVTCYEALTPERIKQFRELYVKARAFIEEVYIPDLLLVASYYKDWGKIGGTNNFMAF
3cusR           ICTYVHALASSRCVDDAVKVSIPANARMMRNLVMASQYLHDHLVHFYHHALDWVDVTAALKAKAVQDKLK
3d7aA           -------------------------------------------------------VEAYVYPTEDIRKVK
2bshA           --------TELQQLFLKLGLNHQVNENDVYTFEVDQVLIACYHQQWVQLFSELGADLPTNDNLFGEHWPA
2bsjA           -----TFTELMQQLFLKLGLNHQVNENDVYTF-----EVDGHIQ-------VLIACYHQQWVQLFSELGA
2bshB           -GAGQTTFTELQQLFLKLGLNHQVNENDVYTFEVDGHIQVLIACYHQQWVQLFSELGA--DLPTNDNLFG
2bsiA           -----TTFTELQQLFLKLGLNHQVNENDVYTFEVDGHIQVLIACYHQQWVQLFSELGA--DLPTNDNLFG
2bhoA           -------TELMQQLFLKLGLNHQVNENDVYTFEVDGHIQVLIACYHQQWVQLFSELG--ADLPTNDNLFG
2dqbD           DYYRTRTHTLEVAQVRSIARALGLNEDLTEALSHDLGPFGHTGEHVLNALQDHGGFEHNAQALRILTHLE


                         +         .         .         .         .         *         .:210
query           VFYERACGARMHSAYVRPGGVHQDLPPELVDDIGKWCDPFLTVLDNIEGLLTDNRIYKQRNVDIGVVSLE
3curH           AFVESGQLGIFTNAYFLGGHKAYYLPPEVDLAHYLEALHMQVKAASAMAILGGKNPHTQF-TVVGGCSNY
3cusQ           AFVESGQLGIFTNAYFLGGHKAYYLPPEVDLAHYLEALHMQVKAASAMAILGGKNPHTQFTVVGGCSNYQ
1cc1L           EMVAMFGGRMPHVQGMVVGGATEIPTADKVAEYAARFKEVQKFVIELPLIYTLGSVYTDNVIAFGVFPED
1e3dB           GEFPAPGGERDLNSRWYKPGVIYDRKVGSVQKIEEHVRHSWYEGKARAPFEGETNPHFTFMGDTDKYSWN
3cusR           AFVESGQLGIFTNAYFLGGHKAYYLPPEVDLIATAHYLEALHMAASAMAILGGKNPHTQFTVVGGCSNYQ
3d7aA           KAMLNLPGLQFEAFDKGEYVILVGRTKDK---------------RALQRLYE-----------LFRGQQI
2bshA           HVQGRLDGKSILWSQQSLVGLDIDEQ--------AWLERFIDDIEQRKEPQN-TKFQP------------
2bsjA           DLPTNDNLFGEHWPAQGRLDGKSILWSQQSLVGLDIDEMLERFIDDIEQRKEPQNTK-------------
2bshB           EHWPAHVQGRLDGKSILWS---QQSLVGLDIDEQAWLERFIDDIEQRK----------------------
2bsiA           EHWPAHVQGRLDGKSILWSQ---QSLVGLDIDEQAWLERFIDDIEQRK----------------------
2bhoA           EHWPAHVQGRLDGKPILWSQ--QSLVGLDIDEMQAWLERFI-----------------------------
2dqbD           VRYPGFRGLNLTYEVLEGIATHYEGQGTLEAQVVDLSDAIAYAAHDLDDGFRAGLL--------------


                         .         .         .         +         .         .         .:280
query           DAFAWGFTGVMVRGSGAAWDLRRSQPYECYSDLEFDIPVGKNGDCYDRYLIRMQEMRESVKIMKQCVDRL
3curH           QGLTKDPLANYLALSKEVCQFVNECYIDLLAVAGFYKDWGGIGGTSNYLAFGEFATDDSSPEKHLATSQF
3cusQ           GLTKDPLANYLALSKEVCQFVNECYIPDLLAVAGFYKDWGGIGGTSNYLAFGEFATDDSSPEKHLATSQF
1cc1L           DDYKTFKPGVYIDGKDEEFDSKLVKEYVGHSFFDHSAPGGLHVGPLARMWVQNPELSPVGQKLLKELYGI
1e3dB           KAPRYVETGPLAQLVAYGHNHKTIKPTIDAVLGKLNLGPEALFSTLGRTAARGIQTLVIAQQMENWLNEY
3cusR           GLTKDPLANYLALSKEVCQFVNECYIPDLLAVAGFYKDWGGIGGTSNYLAFGEFATDDSSPEKHLATSQF
3d7aA           LDTARMMLEEGYFGEEIIIKVHKQVAYVGKVNFNEDSP-----LGPITITIRTKEPQKLMKWLAPRTK--
2bshA           ----------------------------------------------------------------------
2bsjA           ----------------------------------------------------------------------
2bshB           ----------------------------------------------------------------------
2bsiA           ----------------------------------------------------------------------
2bhoA           ----------------------------------------------------------------------
2dqbD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SGKHRIGPVSSLDGKVVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYVVADGSN
3curH           PS----GVITGRDLGKVDN--VDLGAIYEDVKYSWYAPGGDGKHP----YDGVTDPKYTKLDDKDHYSWM
3cusQ           PS----GVITGRDLGKVDNV--DLGAIYEDVKYSWAPGGDGKHPYDGVTDPKYTKLDDKDHYSWMPRYKG
1cc1L           EA----KKFRDLGDKAFSIMGWLTAVAVEKWLKQVQPYVKSEIPDAAEGTGFTEAPRGALLHYLKIKD-K
1e3dB           EN---------------NIVKDKQI------------VEDYAVPTSARGVGFADVSRGGLSHWMTIED-G
3cusR           P-----SGVITGRDLGKVDNVDLGAIYEDVKYSWYAPGGDGKHPYDGVTDPKYTKLDDKDHYSWMKAPRY
3d7aA           ----------------------------------------------------------------------
2bshA           ----------------------------------------------------------------------
2bsjA           ----------------------------------------------------------------------
2bshB           ----------------------------------------------------------------------
2bsiA           ----------------------------------------------------------------------
2bhoA           ----------------------------------------------------------------------
2dqbD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KPYRCKIRAPGYAHLQAMDFLCKGHQLADVTAVLGSLDIVFGEVDR
3curH           KAPRYKGKAMEVGPLARTFIAYQPDFKKVVDMVLGKLSVPATA---
3cusQ           KAMEVGPLARTFIAYAKGQPDFKKV----VDMVLGKLSVPATA---
1cc1L           KIENYQIVSATLWNANPRDDMGQRGPIEE--ALIGVPVPDIKNPVN
1e3dB           KIDNFQLVVPTTWNLGPRDDVADPKRPVEILRTIHSFDPCI-----
3cusR           KGKAMEVGPLARTFIAYAKGQPDFKKVVD-----------------
3d7aA           ----------------------------------------------
2bshA           ----------------------------------------------
2bsjA           ----------------------------------------------
2bshB           ----------------------------------------------
2bsiA           ----------------------------------------------
2bhoA           ----------------------------------------------
2dqbD           ----------------------------------------------