[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK87170.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2e98A.bssp"
#ERROR : Can't open dsspfile "2e99A.bssp"
#ERROR : Can't open dsspfile "2e9dA.bssp"
#ERROR : Can't open dsspfile "2e9aA.bssp"
#ERROR : Can't open dsspfile "2d2rA.bssp"
#ERROR : Can't open dsspfile "2dtnA.bssp"
#ERROR : Can't open dsspfile "2e98B.bssp"
#ERROR : Can't open dsspfile "2e9aB.bssp"
#ERROR : Can't open dsspfile "2e9cB.bssp"
#ERROR : Can't open dsspfile "2dtnB.bssp"
#ERROR : Can't open dsspfile "2d2rB.bssp"
#ERROR : Can't open dsspfile "2e9cA.bssp"
#ERROR : Can't open dsspfile "2b7oA.bssp"
#ERROR : Can't open dsspfile "2eeeA.bssp"
#ERROR : Can't open dsspfile "3bbnT.bssp"

## Summary of PDB Search
:247
    6e-94  47%  2e98A  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    2e-91  47%  2e99A  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    2e-86  45%  2e9dA  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    3e-84  46%  2e9aA  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    4e-83  39%  2d2rA  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHASE
    1e-82  38%  2dtnA  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHASE
    2e-82  46%  2e98B  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    9e-82  47%  2e9aB  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    5e-80  46%  2e9cB  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    6e-74  41%  2dtnB  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHASE
    1e-73  41%  2d2rB  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHASE
    1e-70  47%  2e9cA  [x.x.x] UNDECAPRENYL PYROPHOSPHATE SYNTHETASE
    4e-24  13%  2b7oA  [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
    9e-18  11%  2eeeA  [x.x.x] UNCHARACTERIZED PROTEIN C6ORF130
    9e-09  14%  3bbnT  [x.x.x] RIBOSOMAL PROTEIN S20
:247

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPTTTRSSIPEHVAIIMDGNGRWAKQRGLPRVMGHRRGVEAVRETVRAAGDCGISYLTLFAFSSENWRRP
2e98A           ------AHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRP
2e99A           ------AHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRP
2e9dA           ---------CRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSAQEVSA-
2e9aA           ------AHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSVSA---
2d2rA           -------STLKHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFEVDF----
2dtnA           -------STLKHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFEVDF----
2e98B           ---------CRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSSALMEL
2e9aB           ---------CRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSA------
2e9cB           ---------CRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSSAL---
2dtnB           ---------LKHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYA---------
2d2rB           ---------LKHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLY----------
2e9cA           ------AHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSELDSEV
2b7oA           VERLDPHNKPGRLTLVSRGNHKVRDLLPPIVEKVQATG----HQVIWQCDPHGNTHESSTGFKTRHFDRI
2eeeA           -----NQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEHCLKNGVTDLSMPRIGCGLDRLQ
3bbnT           ----------------------------------------SKKSEARTRMKKVLEALEGLKKKTDAQADE


                         .         .         *         .         .         .         .:140
query           ESEVSDLMGLLKAFIRRDLAELHRENVRVRIIGDRQGLKTDIRSLLEEAEQMTAGNTKLTLVIAFNYGSR
2e98A           AQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGR
2e99A           AQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGR
2e9dA           ------LMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGR
2e9aA           ------LMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGR
2d2rA           ------LMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSK
2dtnA           ------LMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSK
2e98B           FVWAL----------DSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGR
2e9aB           ------LMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGR
2e9cB           -------MELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGR
2dtnB           -------MKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSK
2d2rB           ------LMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSK
2e9cA           K-------------------SLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGR
2b7oA           VDEVQGFFEVHRA------LGTHPGGIHVEITGENVTLAGRYETACDPRLNTQQSLE-----LAFLVAEL
2eeeA           WENVSAMIEEVFEATDIKI---------------------------------------------------
3bbnT           IVTVEKLIGEAYSAIDKAVKVLHKNT--------------------------------------------


                         +         .         .         .         .         *         .:210
query           DEITRATASIARDVAEGRLSADAITPEMISSRLDTSGMPDPDLIIRTSGEERLSNFLLWQAAYSEFLFVP
2e98A           WDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
2e99A           WDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
2e9dA           WDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
2e9aA           WDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
2d2rA           NELSRAFKSLLESPPSN-ISLLESLENEISNRLDTRNLPEVDLLLRTGGEMRLSNFLLWQSSYAELFFTP
2dtnA           NELSRAFKSLLESPPSN-ISLLESLENEISNRLDTRNLPEVDLLLRTGGEMRLSNFLLWQSSYAELFFTP
2e98B           WDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
2e9aB           WDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
2e9cB           WDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
2dtnB           NELSRAFKSLLESPLE----------NEISNRLDTRNLPEVDLLLRTGGEMRLSNFLLWQSSYAELFFTP
2d2rB           NELSRAFKSLLESPLE----------NEISNRLDTRNLPEVDLLLRTGGEMRLSNFLLWQSSYAELFFTP
2e9cA           WDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTD
2b7oA           RD--------------------------------------------------------------------
2eeeA           ----------------------------------------------------------------------
3bbnT           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EYWPDFDRQRFFSAIEQYATRDRRFGxxxxxxxxxxx
2e98A           VLWPDFDEQDFEGALNAFANRE---------------
2e99A           VLWPDFDEQDFEGALNAFANRE---------------
2e9dA           VLWPDFDEQDFEGALNAFANRE---------------
2e9aA           VLWPDFDEQDFEGALNAFANRE---------------
2d2rA           ILWPDFTPKDLENIISDFYKRVR--------------
2dtnA           ILWPDFTPKDLENIISDFYKR----------------
2e98B           VLWPDFDEQDFEGALNAFANRERRF------------
2e9aB           VLWPDFDEQDFEGALNAFANRERR-------------
2e9cB           VLWPDFDEQDFEGALNAFANR----------------
2dtnB           ILWPDFTPKDLENIISDFYKRVRKFG-----------
2d2rB           ILWPDFTPKDLENIISDFYKRVRKFG-----------
2e9cA           VLWPDFDEQDFEGALNAFANRE---------------
2b7oA           -------------------------------------
2eeeA           -------------------------------------
3bbnT           -------------------------------------