[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK87211.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1b5tC.bssp"

## Summary of PDB Search
:306
    2e-20  18%  1b5tC  [c.1.23] PROTEIN (METHYLENETETRAHYDROFOLATE REDUCTASE)
:306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxSIEVMPRTAAKIDDFRNILPDGTRVYIAHIDGTPIADMVSTAKR
1b5tC           --------------------------SFEFFPRTSEMEQTLWNSLSSLKPKFVSVTYSGERDRTHSIIKG


                         .         .         *         .         .         .         .:140
query           LHDEGFPVMPHLPARGISGKNELEDWLKRYQGEAGVTQALLLGGGQKQPAGSFSSSIDMIETGLFDKMGF
1b5tC           IKDRGLEAAPHLTCIDAT-PDELRTIARDYWNNGIRHI-VALRGDLPPYASDLVTLLKEV--------AD


                         +         .         .         .         .         *         .:210
query           THLHLAGHPEGNRDIDSDGSSRGVDQALLWKQDFASRTDARLALTTQFAFEAKVVIEWAKRIGNMGVTIP
1b5tC           FDISVAAYPEVHPEAKSAQADL---LNLKRKVDAGANRAI-----TQFFFDVESYLRFRDRCVSAGIDVE


                         .         .         .         +         .         .         .:280
query           VHVGIAGPTKLQTLIKFAIACGVGPSLKVLQKRALDLSRLFVPYEPTDFIAELIDHKAANPDSLIEHVHI
1b5tC           IIPGILPVSNFKQAKKFADMTNVRIPAQMFDGLDDDAET--RKLVGANIAMDMVKILSREG---VKDFHF


                         .         *         .         .         .         .         +:350
query           FPLGGIKPSAEWMKxxxxxxxxxxxx
1b5tC           YTLNRAEMSYAICH------------