[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK87429.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1bkjA.bssp"
#ERROR : Can't open dsspfile "3bemB.bssp"
#ERROR : Can't open dsspfile "3bm1B.bssp"
#ERROR : Can't open dsspfile "2b67A.bssp"
#ERROR : Can't open dsspfile "3bemA.bssp"
#ERROR : Can't open dsspfile "3bm1A.bssp"
#ERROR : Can't open dsspfile "3ek3A.bssp"
#ERROR : Can't open dsspfile "3e39B.bssp"
#ERROR : Can't open dsspfile "3e10A.bssp"
#ERROR : Can't open dsspfile "3e39A.bssp"
#ERROR : Can't open dsspfile "3bm2A.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"

## Summary of PDB Search
:228
    8e-28  23%  1bkjA  [d.90.1] NADPH-FLAVIN OXIDOREDUCTASE
    3e-27  17%  3bemB  [x.x.x] PUTATIVE NAD(P)H NITROREDUCTASE YDFN
    6e-26  25%  3bm1B  [x.x.x] PROTEIN YDJA
    9e-26  18%  2b67A  [x.x.x] COG0778: NITROREDUCTASE
    8e-25  17%  3bemA  [x.x.x] PUTATIVE NAD(P)H NITROREDUCTASE YDFN
    1e-23  26%  3bm1A  [x.x.x] PROTEIN YDJA
    2e-23  22%  3ek3A  [x.x.x] NITROREDUCTASE
    2e-23  26%  3e39B  [x.x.x] PUTATIVE NITROREDUCTASE
    2e-21  20%  3e10A  [x.x.x] PUTATIVE NADH OXIDASE
    2e-21  24%  3e39A  [x.x.x] PUTATIVE NITROREDUCTASE
    3e-16  25%  3bm2A  [x.x.x] PROTEIN YDJA
    6e-06  25%  3bm2B  [x.x.x] PROTEIN YDJA
:228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxAEREAIYRAIETRRDVRDQFLPDPLPEELVERLLKAAHSAPSVGFMQPWNFT
1bkjA           ----------------------NTIETILAHRSIR-KFTAVPITDEQRQTIIQAGLAASSSSMLQVVSIV
3bemB           ------------------HHHAEFTHLVNERRSAS-NFLSGHPITKEDLNEFELVALAPSAFNLQHTKYV
3bm1B           -----------------------ALELLINRRSAS-RLAEPAPTGEQLQNILRAGMRAPDHKSMQPWHFF
2b67A           -----------------------FLELNKKRHATK-HFTDKLVDPKDVRTAIEIATLAPSAHNSQPWKFV
3bemA           ---------------------AEFTHLVNERRSAS-NFLSGHPITKEDLNEFELVALAPSAFNLQHTKYV
3bm1A           -----------------------ALELLINRRSAS-RLAEPAPTGEQLQNILRAGMRAPDHKSMQPWHFF
3ek3A           -----------------------VLETIKARRSVR-AYDRKQIPADDLNAILEAGAYAPS-GHYETWHFT
3e39B           --------------------ENPVLQAIRQRRSIR-RYTDEAVSDEAVRLILEAGIWAPSGLNNQPCRFL
3e10A           --------------------------IINNRRSIR-NYKGKKVEKEKIEKLLRAAQ-APSAGNQQPWEFI
3e39A           --------------------ENPVLQAIRQRRSIR-RYTDEAVSDEAVRLILEAGIWAPSGLNNQPCRFL
3bm2A           -----------------------ALELLINRRSAS-RLAEPAPTGEQLQNILRAGRA-------QPWHFF
3bm2B           ------------------------------RRSASR-LAEPAPTGEQLQNILRAGRAPDWHFFVIEGEG-


                         .         .         *         .         .         .         .:140
query           LVTDGGVRQAAWVAFSRANEEAAAMFEGEKQALYRSLKLEGIRKAPLSICVTCDPTRGGKVVLGRTHNPR
1bkjA           RVTDSEKR-----------NELAQFAGNQAY----------VESAAEFLVFCIDYQRNPDVQADFTELTL
3bemB           TVLDQDVKEKLKAANGQYKVVSSSAVLLVLGDKQAYQQAADIYEGLKVLGILNKQEYDHVQDTVSFYENR
3bm1B           VIEGEGRERFSAVLEQGAIAAGSDDKAIDKAR-------NAPFRAPLIITVVAKCEENHKV------PRW
2b67A           VVREKNAELYGSNFEQVSSAPVTIALFTDTDLAKRARKIARVGGANNFSEEQLQYFKNLPAEFARYSEQQ
3bemA           TVLDQDVKEKLKAANGQYKVVSSSAVLLVLGDKQAYQQAADIYEGLKVLGILNKQEYDHVQDTVSFYENR
3bm1A           VIEGEGRERAVLEQGAIAAGSDDKAIDKARNAPFR---------APLIITVVAKCEENHKV------PRW
3ek3A           AVCNTVKLEELNERIKGAFAKSDDKHLRERGHSET---YCCYYHAPTLVIVSNEP-------------KQ
3e39B           VIRADDPR-----------CDILAAHTRYGHIVRG---------AKVIILVFLDREAYNEV---------
3e10A           VLEDRENID-----------KLSNFSKYANS----------LKTAPLAIVLLADEEK-----------KI
3e39A           VIRADDPR-----------CDILAAHTRYGHIVRG---------AKVIILVFLDREAYNEV-------KD
3bm2A           VIEGEGRERAVLEQGAIAAGSDDKAIDKARNAPFR---------APLIITVVAKC---------------
3bm2B           -----------RERFSAVLEQGAIAAGSDDKAIDKARNA--PFRAPLIITVVA-------------KVPR


                         +         .         .         .         .         *         .:210
query           TDVYSTVCAIQNLWLAARAEGIGVGWVSIFHDSDVRAILDIPEHIEIVAWLCLGRVDALYTEPELAVKGW
1bkjA           IGAVDSGIMAQNCLLAAESMGLGGVYIGGLSAAQVDELLGLPENSAVLFGMCLGHPDQNP--------EV
3bemB           GEQFKRDEAIRSAFLSAAAAGWDTCPIG-FDAEAVKRILNIDDQFEVVITIGKE-----KTESR---RPR
3bm1B           EQEMSAGCAVMAMQMAAVAQGFGGIWRSGAESPVVREAFGCREQDKIVGFLYLGTPQLKVPDPTPFVTYF
2b67A           VSDYLALNAVANLVLALTDQGIGSNIILGFDKSKVNEVLEIEDRFRPELLITVGYTD--------EKLEP
3bemA           GEQFKRDEAIRNASLSAFLSAAAAGWDTCFDAEAVKRILNIDDQFEVVITIGKEKTE--------SRRPR
3bm1A           EQEMSAGCAVMAMQMAAVAQGFGGIWRSGAESPVVREAFGCREQDKIVGFLYLGTPQLNVPDP-------
3ek3A           WWAGDCACAIEN-FLAATSLGIASCWINQLGVRAYLTSLGVPENHKVYGCVALGYKAEGALLKE------
3e39B           KDHQAAGAAVQNL-LAAHAGAVWLGEIINQAATLLPALALDPARLSFEAAIAAGHP---------AQNGS
3e10A           SEWEQDAAAAENILLEAAYLDLGAVWLGAQPIEENLKEFNLKSNIKPFCVISVGYPENSENKFI------
3e39A           HQ--AAGAAVQNL-LAAHAGAVWLGEIINQAATLLPALALDPARLSFEAAIAAGHPA-------------
3bm2A           -EQESAGCAVAQ---AAVAQGFGGIWRSGAESPVVREAFGCREQDKIVGFLYLGTPQLSINVPD------
3bm2B           WEQESAGCAVAQ---AAVAQGFGGIWRSLTESPVVREAFGCREQDKIVGFLYLGTPQLVPDPTPF-----


                         .         .         .         +         .         .         .:280
query           RQRVPLEELVFRNRWGxx
1bkjA           KPRLPAHVVVHENQYQ--
3bemB           GYRKPVNEFV--------
3bm1B           ------------------
2b67A           SYRLPVDEIIEK------
3bemA           GYRKPVNEFV--------
3bm1A           ------------------
3ek3A           --KTVKAGTI--------
3e39B           SSRRPLAELLLEEPF---
3e10A           --DRFDAKRIHIEKY---
3e39A           ------------------
3bm2A           --PTPFVTYF--------
3bm2B           ------------------