[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK87597.2

[Show Plain Result]

#ERROR : Can't open dsspfile "2akeA.bssp"
#ERROR : Can't open dsspfile "2cyaA.bssp"
#ERROR : Can't open dsspfile "3d6uA.bssp"
#ERROR : Can't open dsspfile "2cybA.bssp"
#ERROR : Can't open dsspfile "3d6vA.bssp"
#ERROR : Can't open dsspfile "2ag6A.bssp"
#ERROR : Can't open dsspfile "2azxA.bssp"
#ERROR : Can't open dsspfile "2dlcX.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "2cybB.bssp"
#ERROR : Can't open dsspfile "3bbnD.bssp"
#ERROR : Can't open dsspfile "1c05A.bssp"
#ERROR : Can't open dsspfile "2cqjA.bssp"
#ERROR : Can't open dsspfile "1dm9A.bssp"

## Summary of PDB Search
:417
    2e-51  18%  2akeA  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    6e-35  15%  2cyaA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    4e-34  18%  3d6uA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    1e-31  18%  2cybA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    4e-30  18%  3d6vA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    3e-25  17%  2ag6A  [x.x.x] TYROSYL-TRNA SYNTHETASE
    1e-22  17%  2azxA  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    1e-22  12%  2dlcX  [x.x.x] TYROSYL-TRNA SYNTHETASE, CYTOPLASMIC
    8e-21  13%  1d2rA  [c.26.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    3e-19  17%  2cybB  [x.x.x] TYROSYL-TRNA SYNTHETASE
    5e-08  13%  3bbnD  [x.x.x] RIBOSOMAL PROTEIN S4
    3e-05  20%  1c05A  [d.66.1] RIBOSOMAL PROTEIN S4 DELTA 41
    5e-04  20%  2cqjA  [x.x.x] U3 SMALL NUCLEOLAR RIBONUCLEOPROTEIN PROTEIN
    5e-04  18%  1dm9A  [d.66.1] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
:417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSRFKSDFLRTLDERGFIHQISDEAGLDELFAKETVTAYIGYDPTASSLHVGHLTQIMMLHWMQKTGHQP
2akeA           IERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVP
2cyaA           -------------ARNTVEIVTEEELKGLLASGARIKGYIGYEPSGV-AHIGWLVWMYKVKDLVEAGVDF
3d6uA           -----------MIKRN-TSEIISEEELREVLKKDEKSAIIGFEPSGK-IHLGHYLQIKKMIDLQNAGFDI
2cybA           -----------LITRNAEEVVTEEELRQLIETKEKPRAYVGYEPSGE-IHLGHMMTVQKLMDLQEAGFEI
3d6vA           -------------KRN-TSEIISEEELREVLKKDEKSAIIGFEPSGK-IHLGHYLQIKKMIDLQNAGFDI
2ag6A           -----------------TSEIISEEELREVLKKDEKSALIGFEPSGK-IHLGHYLQIKKMIDLQNAGFDI
2azxA           IERATGQRPHHFLRRGIFFSHRDNQVLDAYENKKPFYLYTGRGPSSE-AHVGHLIPFIFTKWLQDVFNVP
2dlcX           -------------TKN-LQEVLNPQIIKDVLEKRHLKLYWGTAPT-GRPHCGYFVPMTKLADFLKAGCEV
1d2rA           ------------------------------------TIFSGIQPSGV-ITIGNYIGALRQFVELQHEYNC
2cybB           -------------TRNAEEVVTEEELRQLIETKEKPRAYVGYEPSG-EIHLGHMMTVQKLMDLQEAGFEI
3bbnD           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ISLMGGGTGMVGDPSFKEEARKLMTIDMIEDNITSLKHVFANYLDYDRAENPALMINNADWLRGLNYLEF
2akeA           LV-----IQMTDDEKYL---WKDLTLDQAYSYA---VENAKDIIACGFDINKTFIFSDLDYMGMSSFYKN
2cyaA           SVLEATWHAYINDKLGGDMDLIRAAARIVRRVMEAAGVPVERVRFVDAEE----LASDKDYW--------
3d6uA           IILLADLFAYLNQKGELDEIRK---------IGDYNKKVF-EAMGLK----AKYVYGSSFMLDKDYTLNV
2cybA           IVLLADIHAYLNEKGTFEEIA------------EVADYNKKVFIALGLDESRAKFVLGSEYQLSRDYVLD
3d6vA           IILLADLFAYLNQKGELDEIRKIGDYNKKVFEAMGLKAKY--------------VYGSSFMLDKDYTLNV
2ag6A           IILLADLHAYLNQKGELDEIRK-----IGDYNKKVFE---AMGLKAK-------YVYGSSFQLDKDYTLN
2azxA           LVIQTDDEKYLWKDLTLDQAYG-DAVENAKD------------IIACGFDINKTFIFSDLDYGSSGFYKN
2dlcX           TVLLADLHAFLDNMKAPLEVVNYRAKYYELTI-------KAILRSINVPIEKLKFVVGSSYQLTPDYTMD
1d2rA           YFCIVDQHAITVWQDPHELRQ---NIRRLAALYLAVGIDPTQATLFIQSEVPAH-------------AQA
2cybB           IVLLADIHAYLNEK---------GTFEEIAEVA---DYNKKVFIALGLDESRAKFVLGSEYQLSRDYVLD
3bbnD           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LRDVGRHFSVNRMLSFDSVKTRLDREQSLSFLEFNYMILQAYDFVELNQRTGCRLQMGGSDQWGNIINGI
2akeA           VVKIQKHVTFNQV------KGIFGFTDSDCIGKISFPAIQAAPSIFRDRTDIQCLIPCAIDQDPYFRMTR
2cyaA           ----GLVIRVAKRASLARVRRALAEEAEVDASKLIYPLMQVSDIFYMD----LDIALGGMDQRKAHMLAR
3d6uA           YR-LALKTTLKRARRSMELIAREDENPKVAE--VIYPIMQVNPLHYEG----VDVAVGGMEQRKIHMLAR
2cybA           VLKMARITTLNRARRSMDEVSR--RKEDPMVSQMIYPLMQALDIAHLG----VDLAVGGIDQRKIHMLAR
3d6vA           YR-LALKTTLKRARRSMELIAREDENPKVAE--VIYPIMQVNPLHYEG----VDVAVGGMEQRKIHMLAR
2ag6A           VYRLALKTTLKRARRSMELIAREDENP--KVAEVIYPIMQVNPLHYE----GVDVAVGGMEQRKIHMLAR
2azxA           VVKIQKHVTFNQV------KGIFGFTDSDCIGKISFPAIQAAPSFSNSFRTDIQCLIPCAIDQDPYFRTR
2dlcX           IFRLSNIVSQNDAKRAGADVVK--QVANPLLSGLIYPLMQALDEQ----FLDVDCQFGGVDQRKIFVLAE
1d2rA           AWMLQCIVYIGELERMTQFKEKSAGAAAAAAGLLTYPPLMAADILLY----NTDIVPVGEDQKQHIELTR
2cybB           VLKMARITTLNRARRSMD--EVSRRKEDPMVSQMIYPLMQALDIAH----LGVDLAVGGIDQRKIHMLAR
3bbnD           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DLGHRMGTPQLYALTSPLLTTXXXXXXXXXXXXXVWLNKDLLPVYDFWQYWRNTEDADVVRFAKLFTTLP
2akeA           DVAPRIGYPKPALLHSPALQGAQTKMSASDPNSSIFLTGGRDTIEEHRQFGGNC-DVDVSFMYLTFFLED
2cyaA           DVAEKLGRKKPVAIHTPIISQGPVKMSKSKPETAVFVVDSRRKIRKAYCPAKQVQGNPVLEIARLRVDVE
3d6uA           ELLPK----KVVCIHNPVLTLDGEGKMSSSKGNFIAVDDSPEEIRAEIAKYFLEYPLTIKRPEKFGGDLT
2cybA           ENLPRLGYSSPVCLHTPILVGLDGQKMSSSKGNYISVRDPPEEVERAYCPAGVVEENPILDIAKFGGDVE
3d6vA           ELLPK----KVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDEGNPIMEIAKYFLEYPLTIKRPEKFGGDLT
2ag6A           ELLPKKGKMSSSKGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRPEKFGGDLT
2azxA           DVAPRIGYPKPALLHSTFFAQTKSASDPNSSIFLTDTAKQIKTKEEHRQFGGN--CDVDVSFYLTFFLED
2dlcX           ENLPSLGYKKRAHLMNPMVPSAFCSPGNVEENGLLSFVQYVIAPIQELKFGTNHFEFFIDRPEKFGGPIT
1d2rA           DLAERFNKRYGELFTIPEARVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSEAKPGISNLLNIYSTLS
2cybB           ENLPRLGYSSPVCLHTPILVGLDGQKMSSSKGNYISVRRKIRKAYCPAGVVEENPILDIAKYHILPRFGK
3bbnD           ------------------------------------------------------------RLGALPGLTN
1c05A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           MDEIARIATLGGSEINEAKKILATEVTAILHGXXXXXXXXXXXXXXXXXGALAENLPSIEVPTSELDAGV
2akeA           DDKLEQIRTSGAMLTGELKKALIEVLQPLIAE--------------------------------------
2cyaA           YTSYEELETDGRLHPLDLKNAVAESLIEVVRP--------------------------------------
3d6uA           VNSYEELESNKELHPMDLKNAVAEELIKILEP--------------------------------------
2cybA           YASFEELEDFKSGQLHDLKIAVAKYLNMLLE---------------------------------------
3d6vA           VNSYEELESLKELHPMDLKNAVAEELIKILEP--------------------------------------
2ag6A           VNSYEELESLKELHPMDLKNAVAEELIKILEP--------------------------------------
2azxA           DDKLEQIDYTSGALTGELKKALIEVLQPLIAE--------------------------------------
2dlcX           YKSFEEMKLEEKLSPPDLKIGVADAINELLEP--------------------------------------
1d2rA           GQSIEELRQYEGKGYGVFKADLAQVVIETLRP--------------------------------------
2cybB           IVVERDAGDVEYASFEDLKIAVAKYLNMLLE---------------------------------------
3bbnD           KRPRAGSDLRNQSKRSQYRIRLEEKQKLRFHYGITERQLLKYVRI----ARKAKGSTGQVL---LQLLEM
1c05A           ----------------------------------------------------AGKMPGKHGENFMILLES
2cqjA           ----------------------------------------------------------------------
1dm9A           ------------------------------------------------------------------AVEV


                         .         .         .         .         *         .         .:420
query           GVLSLIVRAGLASSNGEARRHVQGGAVKINEQGVSDERQIIGTGEVTGDGVIKLSVGKKKHVLVRPA
2akeA           -------------------------------------------------------------------
2cyaA           -------------------------------------------------------------------
3d6uA           -------------------------------------------------------------------
2cybA           -------------------------------------------------------------------
3d6vA           -------------------------------------------------------------------
2ag6A           -------------------------------------------------------------------
2azxA           -------------------------------------------------------------------
2dlcX           -------------------------------------------------------------------
1d2rA           -------------------------------------------------------------------
2cybB           -------------------------------------------------------------------
3bbnD           RLDNILFRLGMAPTIPGARQLVNHRHILVNGRIVDIPSYRCKPQD----------------------
1c05A           RLDNLVYRLGLARTRRQARQLVTHGHILVDGSRVNIPSYRVKPGQT---------------------
2cqjA           ----VLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSFVTWVDSSKISGPS---------
1dm9A           RLDKWLWAARFYKTRALAREMIEGGKVHYNGQRSKPSKIV-----ELNA-TLTLRQGNDERTVIVKA