[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK87761.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dn9A.bssp"
#ERROR : Can't open dsspfile "2ctwA.bssp"
#ERROR : Can't open dsspfile "2cugA.bssp"
#ERROR : Can't open dsspfile "2ctrA.bssp"
#ERROR : Can't open dsspfile "2ctqA.bssp"
#ERROR : Can't open dsspfile "2ctpA.bssp"
#ERROR : Can't open dsspfile "2ej7A.bssp"
#ERROR : Can't open dsspfile "2dmxA.bssp"
#ERROR : Can't open dsspfile "1c4pC.bssp"
#ERROR : Can't open dsspfile "1bq0A.bssp"
#ERROR : Can't open dsspfile "3bvoB.bssp"
#ERROR : Can't open dsspfile "2dodA.bssp"

## Summary of PDB Search
:200
    1e-13  45%  2dn9A  [x.x.x] DNAJ HOMOLOG SUBFAMILY A MEMBER 3
    6e-13  32%  2ctwA  [x.x.x] DNAJ HOMOLOG SUBFAMILY C MEMBER 5
    9e-13  42%  2cugA  [x.x.x] MKIAA0962 PROTEIN
    9e-12  38%  2ctrA  [x.x.x] DNAJ HOMOLOG SUBFAMILY B MEMBER 9
    2e-11  28%  2ctqA  [x.x.x] DNAJ HOMOLOG SUBFAMILY C MEMBER 12
    2e-11  38%  2ctpA  [x.x.x] DNAJ HOMOLOG SUBFAMILY B MEMBER 12
    3e-11  42%  2ej7A  [x.x.x] HCG3 GENE
    1e-10  40%  2dmxA  [x.x.x] DNAJ HOMOLOG SUBFAMILY B MEMBER 8
    1e-10   6%  1c4pC  [d.15.5] PROTEIN (STREPTOKINASE)
    2e-10  35%  1bq0A  [x.x.x] DNAJ
    5e-10  20%  3bvoB  [x.x.x] CO-CHAPERONE PROTEIN HSCB, MITOCHONDRIAL
    2e-09  14%  2dodA  [x.x.x] TRANSCRIPTION ELONGATION REGULATOR 1
:200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIDPYVLLGVERDADEAAIKTAYRKVAKAAHPDSGGDGEQFARLQTAYELLKDPVRRRVFDDTGYDPQxx
2dn9A           --DYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSGP---
2ctwA           --SLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDADKFKEINNAHAILTDATKRNIYDKYGSLG---
2cugA           -FDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGRFIQISKAYEILSNEEKRTNYDHYGSGP---
2ctrA           ----YDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPAKFREIAEAYETLSDANRRKEYDTLGHSA---
2ctqA           --DYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPTFQKLQKAKEILTNEESRARYDHWRRSQ---
2ctpA           --DYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGAFKAIGTAYAVLSNPEKRKQYDQFGSGP---
2ej7A           MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPAERRFKQVAEAYEVLSDAKKRDIYDRYGSGP---
2dmxA           MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDEKKFKLVSEAYEVLSDSKKRSLYDRAGCDS---
1c4pC           --KLLKTLAIGDTITSQELLAQAQSILNKTHPGYTDSSIVTHDNDIFRTILPMDQEFTYHVKNREQA---
1bq0A           --DYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEFKEIKEAYEVLTDSQKRAAYDQYGHAA---
3bvoB           --DYFSLCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQEKHSTLVNDAYKTLLAPLSRGLYLLKEDR----
2dodA           ---------ERAIVPLEARMKQFKDMLLERGVSAFSTELHKIVFDPRYLLLNPKERKQVFDQYVKTRA--


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dn9A           ----------------------------------------------------------------------
2ctwA           ----------------------------------------------------------------------
2cugA           ----------------------------------------------------------------------
2ctrA           ----------------------------------------------------------------------
2ctqA           ----------------------------------------------------------------------
2ctpA           ----------------------------------------------------------------------
2ej7A           ----------------------------------------------------------------------
2dmxA           ----------------------------------------------------------------------
1c4pC           ----------------------------------------------------------------------
1bq0A           ----------------------------------------------------------------------
3bvoB           ----------------------------------------------------------------------
2dodA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dn9A           ------------------------------------------------------------
2ctwA           ------------------------------------------------------------
2cugA           ------------------------------------------------------------
2ctrA           ------------------------------------------------------------
2ctqA           ------------------------------------------------------------
2ctpA           ------------------------------------------------------------
2ej7A           ------------------------------------------------------------
2dmxA           ------------------------------------------------------------
1c4pC           ------------------------------------------------------------
1bq0A           ------------------------------------------------------------
3bvoB           ------------------------------------------------------------
2dodA           ------------------------------------------------------------