[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK87844.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d0qA.bssp"
#ERROR : Can't open dsspfile "3beoA.bssp"
#ERROR : Can't open dsspfile "3dzcA.bssp"
#ERROR : Can't open dsspfile "3d0rB.bssp"
#ERROR : Can't open dsspfile "3d0rA.bssp"
#ERROR : Can't open dsspfile "3c4qA.bssp"
#ERROR : Can't open dsspfile "3c4qB.bssp"
#ERROR : Can't open dsspfile "3cv3A.bssp"
#ERROR : Can't open dsspfile "3c48B.bssp"
#ERROR : Can't open dsspfile "2cb0B.bssp"
#ERROR : Can't open dsspfile "2bn4A.bssp"
#ERROR : Can't open dsspfile "3c3jB.bssp"
#ERROR : Can't open dsspfile "3c3jA.bssp"

## Summary of PDB Search
:378
    1e-15  15%  3d0qA  [x.x.x] PROTEIN CALG3
    6e-15  12%  3beoA  [x.x.x] UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
    1e-12  13%  3dzcA  [x.x.x] UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
    2e-11  16%  3d0rB  [x.x.x] PROTEIN CALG3
    7e-10  16%  3d0rA  [x.x.x] PROTEIN CALG3
    3e-09  13%  3c4qA  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    4e-08  13%  3c4qB  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    6e-05  11%  3cv3A  [x.x.x] GLUCURONOSYLTRANSFERASE GUMK
    1e-04  14%  3c48B  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    8e-04  16%  2cb0B  [x.x.x] GLUCOSAMINE-FRUCTOSE-6-PHOSPHATE
    8e-04  15%  2bn4A  [x.x.x] NADPH CYTOCHROME P450 REDUCTASE
    0.001   9%  3c3jB  [x.x.x] PUTATIVE TAGATOSE-6-PHOSPHATE KETOSE/ALDOSE
    0.001   9%  3c3jA  [x.x.x] PUTATIVE TAGATOSE-6-PHOSPHATE KETOSE/ALDOSE
:378

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNKGIVLLAAGGTGGHVFPAEALAHTLKARGYQVHLVTDSRAERYAGKFPADEIHVVPSATIGSKNPISV
3d0qA           -----VLFVSSPGIGHLFPLIQLAWGFRTAGHDVLIAVAEHADRAAAEQVAKDNPRFAETVATAIDLEEW
3beoA           MTERLKVMTIFGTRPEAIKMAPLVLELQKHPEKIESIVTVTAQHRQMLDQVLSIFGIT-PDFDLNIMKDR
3dzcA           -----KVLIVFGTRPEAIKMAPLVQQLCQDNRFVAKVC--VTGQHREMLDQVLELFSITPDFDLNIMEPG
3d0rB           -----VLFVSSPGIGHLFPLIQLAWGFRTAGHDVLIAVAEHADRAAKVFEQVAKDNPRFAETVATRPAID
3d0rA           -----VLFVSSPGIGHLFPLIQLAWGFRTAGHDVLIAVAEHADRAAKVFEQVAKDNPRFAETVATRPAID
3c4qA           ----LQQPGTGDSGGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIAAGPYEGLSK
3c4qB           ----LQQPGTGDSGGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIAAGPYEGLSK
3cv3A           -------------DMRLPLDDTANTVVSHNGVDCYLWR-----TTVHPFNTRRSWLRP-----------V
3c48B           ------------QQGMNVYILSTATELAKQGIEVDIYT--RATRPSQGEIVRVAENLRVINIAAGPYEGL
2cb0B           ----ILYLGCGSSHFL---AKLLAVTNHGGTGVALPCSEFLYSKEAYPIGKPELVVGISRSGETTEVLLA
2bn4A           NNKNYLVLYASQTGTAEDYAKKFSKELVAKFNLNVMCADVENYDFESLNDVPVIVSIFISTYGEGDFPDG
3c3jB           -ENLRIILTGAGTSAFI--GDIIAPWLASHTGKNFSAVPTTDLVTNPYLNPAHPLLLIGRSGNSPESVAA
3c3jA           -ENLRIILTGAGTSAFI--GDIIAPWLASHTGKNFSAVPTTDLVTNPYLNPAHPLLLIGRSGNSPESVAA


                         .         .         *         .         .         .         .:140
query           VRSLWKLWVGLRTARRLVTKLKPVAVVGFGGYPTVPPLLASTGLGVPSIIHEQNAVMGRANKALAARVKA
3d0qA           GVQIAAVNRPLVDGTALVDDYRPDLVVYEQGATVGLLAADRAGVPAVQRNQSAWRTRGHRSIASFLTDLD
3beoA           QTLIDITTRGLEGLDKVMKEAKPDIVLVHGDTTTTFISLAAFYNQIPVGHVEAGEMNRQLTGVMADLHFS
3dzcA           QTLNGVTSKILLGMQQVLSSEQPDVVLVHGDTATTFAALAAYYQQIPVGHVEAGEGNRKLTAALTQYHFA
3d0rB           LEEWGVQIAAVDGTMALVDDYRPDLVVYEQGAAGVPAVQRNQSAWRTRGMHRSIASFLTDLMDKHQVSLP
3d0rA           LEEWGVNRPLVDGTMALVDDYRPDLVVYEQGATVGLLAADRAGVPAVQRNQSAWRTRGMHRKHQVSLPEP
3c4qA           EELPTQLAAFTGGMLSFTRREKVTYDLIHSHYWLSGQWLLRDLWRIPLIHTAHTLAAVICEQQLVDNADV
3c4qB           EELPTQLAAFTGGMLSFTRKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHTAHTLAAVSDTPESEARRIC
3cv3A           EDAMFRWYAAHPPKQLLDWMRESDVIVFESGIAVAFIELAKRVNPAAKLVY-------------------
3c48B           SKEELPTFTGGMLSFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHTAHT----------------
2cb0B           LEKI------------------------------------------------------------------
2bn4A           AVNFEDFICNAEAGA---LSNLRYNMFGLGNST-------------------------------------
3c3jB           VELANQFVPECYH---------------------------------------------------------
3c3jA           ----------VELANQFVPECYHLPITC------------------------------------------


                         +         .         .         .         .         *         .:210
query           IAGGFLPPANGQYSEKTVATGNPVRPAVLAASEIPYTPSQTGETFQLVVFGGSQGAQFFSSAVPAAICLM
3d0qA           KHQVSLPEPVPSLLLEAEPEGWFRWVPYGGGAVLGDRLPPVPARPEVAITGTIELQAFGIGAVEPIIAAA
3beoA           PTAKSATQKENKDESRIFITGNTAIDAVKETYSHPVLEKLGNNRLVLMTAHRRENLGEPMRNMFRAIKRL
3dzcA           PTDTSRANLLNYNAENIFVTGNTVIDALLTLESQFPMLDASKKLILVTGHRRESFGGGFERICQALITTA
3d0rB           EPVATIESFPPSLLLEAEPEGWFMRWVPYGGGVLGDRLPPVPARPEVAITMGTIELQAFGIGAVEPIIAA
3d0rA           VATIESFPPSLLLEAEPEGWFMRWVPYGGGAVLGDRLPPVPARPEVAITMGTIELQAFGIGAVEPIIAAA
3c4qA           LEMQDLMHHYDADPDRISVVSPGADVELYSPGNDRATERSPLHTKVVAFVGRLQPFKGPQVLIKAVAALF
3c4qB           EQQLVLMHHYDADPDRISVVSPGASPGNDRATERSRRELGIPLHTKVVAFVGRLQPFKGPQVLIKAVAAL
3cv3A           ----------------------------------------------------------------------
3c48B           ----------------------------------------------------------------------
2cb0B           ----------------------------------------------------------------------
2bn4A           ----------------------------------------------------------------------
3c3jB           ----------------------------------------------------------------------
3c3jA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KDEQRKRIVVTQQARPEDKDSVIASYQKLGVKADVSPFFGDMASRIGEADLVISRSGASTVSELSVIGRP
3d0qA           GEVDADFVLALGDLDISPLGT---------LPRNVRAVGWTPLHTLLRTCTVVHHGGGGTVTAIDA-GIP
3beoA           VDKHEDVQVVYPVHMNPVVRETANDILGDYGRIHLIEPLDVDFHNVAARSYLMLTDSGGVQEEAPSLGVP
3dzcA           EQHPECQILYPVHLNPNVREPVNKLLKGVSNIVLIEPQQYLPFVYLMDRAHIILTDSGGIQEEAPSLGKP
3d0rB           AGEVDADFVL--ALGDLDISPLGTLPRNVRA-----VGWTPLHTLLRTCTAVVHHGGGGTVMTAIDAGIP
3d0rA           GEVDADFVLA---LGDLDISPLGTLPRNVRAVGWT-----PLHTLLRTCTAVVHHGGGGTVMTAIDAGIP
3c4qA           DRDPDRNLRVIICGGPTYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFGLVAMEAQASGTP
3c4qB           FDRDPDRNLRVIICGGPYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFGLVAMEAQASGTP
3cv3A           ----------------------------------------------------------------------
3c48B           ----------------------------------------------------------------------
2cb0B           ----------------------------------------------------------------------
2bn4A           ----------------------------------------------------------------------
3c3jB           ----------------------------------------------------------------------
3c3jA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SILVPYPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d0qA           QLLAPDP---------------------------------------------------------------
3beoA           VLVLRDT---------------------------------------------------------------
3dzcA           VLVMRET---------------------------------------------------------------
3d0rB           QLLAPDP---------------------------------------------------------------
3d0rA           QLLAPDP---------------------------------------------------------------
3c4qA           VIAARVG---------------------------------------------------------------
3c4qB           VIAARVG---------------------------------------------------------------
3cv3A           ----------------------------------------------------------------------
3c48B           ----------------------------------------------------------------------
2cb0B           ----------------------------------------------------------------------
2bn4A           ----------------------------------------------------------------------
3c3jB           ----------------------------------------------------------------------
3c3jA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d0qA           ----------------------------
3beoA           ----------------------------
3dzcA           ----------------------------
3d0rB           ----------------------------
3d0rA           ----------------------------
3c4qA           ----------------------------
3c4qB           ----------------------------
3cv3A           ----------------------------
3c48B           ----------------------------
2cb0B           ----------------------------
2bn4A           ----------------------------
3c3jB           ----------------------------
3c3jA           ----------------------------