[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK87903.2

[Show Plain Result]

#ERROR : Can't open dsspfile "2afaA.bssp"
#ERROR : Can't open dsspfile "1clcA.bssp"
#ERROR : Can't open dsspfile "3e6uD.bssp"
#ERROR : Can't open dsspfile "3e73A.bssp"
#ERROR : Can't open dsspfile "1dl2A.bssp"
#ERROR : Can't open dsspfile "3e6uB.bssp"

## Summary of PDB Search
:415
    2e-20  33%  2afaA  [x.x.x] NAG ISOMERASE
    5e-07  11%  1clcA  [x.x.x] ENDOGLUCANASE CELD EC: 3.2.1.4
    3e-05   8%  3e6uD  [x.x.x] LANC-LIKE PROTEIN 1
    6e-05   9%  3e73A  [x.x.x] LANC-LIKE PROTEIN 1
    8e-05   8%  1dl2A  [a.102.2] CLASS I ALPHA-1,2-MANNOSIDASE
    3e-04  10%  3e6uB  [x.x.x] LANC-LIKE PROTEIN 1
:415

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxHRQWLVKQVEGLFDFFQHRALNPAGGFFDLDAKGAPLQANDPVRGIHASARMVH
2afaA           ----------------HNRWLEQETDRIFNF---GKNAVVPTGFGWLGNKGQIK-EEGTHLWITARLHVY
1clcA           -----------------------------------------------------------EIPEKNNSIPD
3e6uD           ----------------------------------------------------------------------
3e73A           ----------------------------------------------------------------------
1dl2A           ----------------------------------------------------------------------
3e6uB           ------------------------------------------------------------------NCLT


                         .         .         *         .         .         .         .:140
query           CFSIGHLLGRPGCGDIVDHGMTYLWNNHRDGEHGGYFWQVNDAGPVDATKQGYGHAFVLLAASSAKTVGH
2afaA           SV---AASGRPGAYDLVDHGIKANGALR-DKKYGGWYACVNDQGVVDASKQGYQHFFALLGAASAVTTGH
1clcA           FLDELKYEIDWILTMQYPDGSGRVAHKVSTRNFGGFIMPENEHDERFFVPWSSAATADFVAMTAMAAIFR
3e6uD           -----------------------------------NKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIP
3e73A           --------------------------------IHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIP
1dl2A           ----------------------------------------------------------------------
3e6uB           KRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHEMLYGRIGYIYALLFVNKNFGVEK


                         +         .         .         .         .         *         .:210
query           PLADQMLADITEVLETRFWEEKHGAIAEEFNRDWSPIDNYRGQNSNMHLTEALMAAYEATGDSNYLTKAE
2afaA           PEARKLLDYTIEVIEKYFWSEEEQCLE--SWDEAFSQTEDYRGGNANHAVEAFLIVYDVTHDKKWLDRAL
1clcA           PYDPQYAEKCINAAKVSYEFLKNNPANVFANQSGFSTGEYATVSDADDRLWAAAEMWETLGDEEYLRDFE
3e6uD           QSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVK
3e73A           QSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVK
1dl2A           ---------------------------------------HTSHNMPRGNQPLGWIIVDSVDTLMLMYNSS
3e6uB           IPQSHIQQICETILTSNLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVK


                         .         .         .         +         .         .         .:280
query           RIADLVIRRRAGELDFRVPEHFDENWTLDKAYRGNEMFRPSGSTPGHWLEWARLILQLWVLGERQHDWMP
2afaA           RIASVIIHDVARNGDYRVNEHFDSQWNPIRDYNPAHRFRAYGGTPGHWIEWGRLLAALEARFETPPAWLL
1clcA           NRAA------------QFSKKIEADFDWD-----------------NVANLGMFTYLLSERPGKNPALVQ
3e6uD           PSVDYVCQ------------LKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDA-
3e73A           PSVDYVCQLKFPSGNYPPCIGDNRDL------------------LVHWCHGAPGVIYIQAYKVFREEKYL
1dl2A           TLYKSEFEAEIQRSEHWINDVLDDIDAEVNVFETTIRMLGGLLSAYHLSDVLEVGNKTVYLNK-------
3e6uB           PSVDYVCQLK--------------------------------FPSGNYPPCIGDNRDLLVHWCHGAPGVI


                         .         *         .         .         .         .         +:350
query           VAAKSLFVQSMALGWDREKGGFFYTLDWNDNPDKRAKLWWPMCEAAGAAHFLNENLPADAFYEDSYRRIW
2afaA           EDAKGLFHATIRDAWAPDGADGFVYSVDWDGKPIVRERVRWPIVEAGTAYALYT-LTDDSQYEEWYQKWW
1clcA           SIKDSLLSTADSIVRTSQNHGYGRTLGTTYY-------WGCNGTVVRQTMILQVKISPNNDYVNAALDAI
3e6uD           -------------------YQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQ-DMKYLYRACKFA
3e73A           CDAYQCADVIWQYGLLKKGYGL----------------CHGSAGNAYAFLTLYN-LTQDMKYLYRACKFA
1dl2A           --AIDLGDRLALAFLSTQTGIPYSSINLHS------GQAVKNHADGGASSTAEFTTLQMEFKYLAYLTGN
3e6uB           YMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQ-DMKYLYRACKFA


                         .         .         .         .         *         .         .:420
query           STIANNFIDHENGGWHEELTEDLVPAHTLFPGKGDIYHALQACLIPLFPAAGSLTTVIxxxxxxx
2afaA           DYC-IKYLDYENGSWWQELDAD----NKVTTGKQDIYHLLHCLVIPRLPLAPGLAPAV-------
1clcA           SHVFGRNYYNRSYVTGLGINPPMNPHD--------------------------------------
3e6uD           EWCLEYGEHGCRTPDTPF-----------------------------------------------
3e73A           EWCLEYGEHGCRTPDTPF-----------------------------------------------
1dl2A           RT---------------------------------------------------------------
3e6uB           EWCLEYGEHGCRTPDTPF-----------------------------------------------