[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK87951.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b70B.bssp"
#ERROR : Can't open dsspfile "1e7zA.bssp"
#ERROR : Can't open dsspfile "2cwpA.bssp"
#ERROR : Can't open dsspfile "2e8gA.bssp"
#ERROR : Can't open dsspfile "3bu2A.bssp"

## Summary of PDB Search
:113
    8e-20  18%  1b70B  [a.6.1 - b.40.4 - b.153.1 - a.6.1 - d.104.1 - d.58.13]
    1e-19  18%  1e7zA  [b.40.4] ENDOTHELIAL-MONOCYTE ACTIVATING POLYPEPTIDE II
    6e-19  26%  2cwpA  [x.x.x] METRS RELATED PROTEIN
    4e-08  22%  2e8gA  [x.x.x] HYPOTHETICAL PROTEIN PH0536
    4e-05  17%  3bu2A  [x.x.x] PUTATIVE TRNA-BINDING PROTEIN
:113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxEISYADFEKVDIRVGTIVEAVPFPEARKPAIKVKIDFGPEIGIKKSSAQITVHYTPESLVGRQVLGV
1b70B           ---RIERVFPIPRGVVFARVLEAHPIPGTRL--KRLVLDAGRTVEVVSGAENARKIGVALALPGTELPGL
1e7zA           ------PIDVSRLDLRIGCIITARKHPDADSL-YVEEVDVGEI-APRTVVSGLVNHVPLEQMQNRMVILL
2cwpA           ---LYDVDEFWKFQMKVGLVKKAEKIKRTKKL-IKLIVDFGNEE--RTIVTGIADQIPPEELEGKKFIFV
2e8gA           -------------DIVVGEVMSVGKHPSADRL-LVTNVNIGERA--------VTVVTNDLTVKEGNRVAV
3bu2A           ---TYKLDADFTPKFVVGYVETKDKHPDADKL-SVLSVDVATEKLQIVCGAP------------------


                         .         .         *         .         .         .         .:140
query           VNFPPRQIGPFRSEVLTLGFADANGDIVLAAVERPVPNGEKMx
1b70B           GKVGERVIQGVRSFGMALSPRE---------------------
1e7zA           CNLKPAKMRGVLSQAMVMCASSPEKI-EILAPPNGSVPGDRI-
2cwpA           VNLKPKKFSGVESQGMLILAETEDGKVYLIPVPEEVPVGARV-
2e8gA           ALLPPRNFFGIVSEGMFLGAGEG-VLKNVKGEIGGLPKGIP--
3bu2A           -------------------------------------------