[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK87977.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bi0A.bssp"
#ERROR : Can't open dsspfile "2c2iA.bssp"
#ERROR : Can't open dsspfile "3dozD.bssp"
#ERROR : Can't open dsspfile "3b7jB.bssp"
#ERROR : Can't open dsspfile "3b7jC.bssp"
#ERROR : Can't open dsspfile "3d04F.bssp"
#ERROR : Can't open dsspfile "3dp3D.bssp"
#ERROR : Can't open dsspfile "3d04B.bssp"
#ERROR : Can't open dsspfile "3d6xF.bssp"
#ERROR : Can't open dsspfile "2b3mA.bssp"
#ERROR : Can't open dsspfile "3bnvA.bssp"
#ERROR : Can't open dsspfile "3d6xE.bssp"
#ERROR : Can't open dsspfile "3d6xA.bssp"
#ERROR : Can't open dsspfile "3bnvB.bssp"
#ERROR : Can't open dsspfile "3bnvG.bssp"
#ERROR : Can't open dsspfile "3bnvH.bssp"
#ERROR : Can't open dsspfile "3bnvF.bssp"
#ERROR : Can't open dsspfile "2b3nA.bssp"
#ERROR : Can't open dsspfile "3d6xB.bssp"
#ERROR : Can't open dsspfile "3bnvD.bssp"
#ERROR : Can't open dsspfile "2cy9B.bssp"
#ERROR : Can't open dsspfile "3b7kB.bssp"
#ERROR : Can't open dsspfile "3d6xC.bssp"
#ERROR : Can't open dsspfile "2e67A.bssp"

## Summary of PDB Search
:155
    3e-16  13%  2bi0A  [x.x.x] HYPOTHETICAL PROTEIN RV0216
    2e-14  21%  2c2iA  [x.x.x] RV0130
    4e-11  16%  3dozD  [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
    1e-10  13%  3b7jB  [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
    2e-10  14%  3b7jC  [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
    1e-09  13%  3d04F  [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
    1e-09  15%  3dp3D  [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
    3e-09  15%  3d04B  [x.x.x] (3R)-HYDROXYMYRISTOYL-ACYL CARRIER PROTEIN
    6e-09  15%  3d6xF  [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
    7e-09  19%  2b3mA  [x.x.x] HYPOTHETICAL PROTEIN AF1124
    4e-08   8%  3bnvA  [x.x.x] CJ0977
    6e-08  14%  3d6xE  [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
    9e-08  15%  3d6xA  [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
    2e-07   9%  3bnvB  [x.x.x] CJ0977
    4e-07   9%  3bnvG  [x.x.x] CJ0977
    2e-06  10%  3bnvH  [x.x.x] CJ0977
    2e-06   9%  3bnvF  [x.x.x] CJ0977
    2e-06  24%  2b3nA  [x.x.x] HYPOTHETICAL PROTEIN AF1124
    5e-06  13%  3d6xB  [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
    2e-05   9%  3bnvD  [x.x.x] CJ0977
    1e-04  11%  2cy9B  [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2
    1e-04  15%  3b7kB  [x.x.x] ACYL-COENZYME A THIOESTERASE 12
    3e-04  14%  3d6xC  [x.x.x] (3R)-HYDROXYMYRISTOYL-[ACYL-CARRIER-PROTEIN]
    7e-04  16%  2e67A  [x.x.x] HYPOTHETICAL PROTEIN TTHB029
:155

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRLAELSPIGERVTLDTLHFSAEDIIRFARDFDPQPFHLDAEAARNSVFGGLCASGWHTGAGWMKSFLSH
2bi0A           --------KGQVFDWAPGVLSLGLAAAHQSVGNRLRLALDSDLCAAVTGPGPLAHPGLVCDVAIGQSTLA
2c2iA           --------------SDWVTITQEEVNLFADTGDHQWIHVDPERAAAGPFGTTIAHGFTLALLPRLQHQYT
3dozD           -----------------TELQANQKIVAYKNITFNEDVFNGHFPNKPIFPGIVEGMAQSGGFLAFTSLWG
3b7jB           -HILQILPRYPMLLVDRITELQANQKIVAYNITFNEDVFNGHFPNKPIFPGIVEGMAQSGGFLAFTSLWG
3b7jC           ---------YPMLLVDRITELQANQKIVAYNITFNEDVFNGHFPNKPIFPGIVEGMAQSGGFLAFTSLWG
3d04F           ---------YPMLLVDRITELQANQKIVAYNITFNEDVFNGHFPNKPIFPGIVEGMAQSGGFLAFTSLWG
3dp3D           -HILQILPRYPMLLVDRITELQANQKIVAYNITFNEDVFNGHFPNKPIFPGIVEGMAQSGGFLAFTSLWG
3d04B           ---------YPMLLVDRITELQANQKIVAYNITFNEDVFNGHFPNKPIFPGVLIVEGMAQSGGFLAFTSL
3d6xF           -------QIQEILPHRYPFLLVDKITELKVKVVLGYKNISISDHVFGHFGHPIYPGVLI-LEGAQTGGVL
2b3mA           ---------GYRFEYEKKLCEIDVAMFGLISGDLNPVHFDEDFASKTRFGGRVVHGMLT-----TSLVSA
3bnvA           -------ASAEDISR--VRAELLTCPELNTSLAGTIIEIDKNYAKSITTSEVADDQGLIFDAFIFAAANY
3d6xE           -------QIQEILPHRYPFLLVDKITELKVKVVLGYKNISISDHVFGHFPGHPYPGVLI-LEGAQTGGVL
3d6xA           -------QIQEILPHRYPFLLVDKITELKVKVVLGYKNISISDHVFGHFGHPIYPGVLILEGAQTGGVLA
3bnvB           -------ASAEDISR-VRAELLTCPE-LNTSLAGTIIEIDKNYAKSITTSEVADDQGLIFDAFIFAAANY
3bnvG           -----------------------TCPELNTSLAGTIIEIDKNYAKSIADDQGLIFDAFI-FAAANYVAQA
3bnvH           ---------------------------LNTSLAGTIIEIDKNYAKSIADDQGLIFDAFI-FAAANYVAQA
3bnvF           ---------------------------LNTSLAGTIIEIDKNYAKSITTSEVADDQGLIFDAFIFAAANY
2b3nA           ----------------------IDVAMFGLSGDLNPVHFDEDFASKTRFGGRVVHGMLT--------TSL
3d6xB           VQIQEILPHYPFLLVDKI----TELKVKEVLGYKNISISDHVFGHFPGHPIYP--GVLI-LEGAQTGGVL
3bnvD           ----QLEEYASAEDISRVRAELLTCPELNTSLAGTIIEIDKNYAKSIADDQGLIFDAFI-FAAANYVAQA
2cy9B           ----------------TQNLREVKVFGFDRVLKVTLVSAAPEKLICEKVEEQHTNKLGTLHGGLTATLVD
3b7kB           -----------AAERRKVRLQHEDGTSVQSIELVLPPHANH---HGNTFGGQIMAWMETVATISASRLC-
3d6xC           ----------------------TELKVKEVLGYKNISISDHVFGHFPGHP--IYPGVLI-LEGAQTGGVL
2e67A           ------------------------------TPFPQVRFLDPYGLPPEERLGFYLDLAHLPPGLYYLVHHS


                         .         .         *         .         .         .         .:140
query           WAKEVKRLKLQGLEPPKLGPSPGFRELKWKKPVFAGDDVTYFVTLLDARPLESRPGIWLNITFNEGVNQS
2bi0A           T--------------QRVKANLFYRGLRFHRFPAVGDTLYTRTEVVGLRANSPKPGPTGLAGLRTTIDRT
2c2iA           VKG------------VKLAINYGLNKVRFPAPVPVGSRVRATSSLVGVEDLGNGTVQATVSTTVEVEGSA
3dozD           FDPEI--------AKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEV-----LKHKGMIW---QVGGTAQVD
3b7jB           FDPEI--------AKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLKHKG--------MIWQVGGTAQVD
3b7jC           FDPEI--------AKTKIVYFMTIDKVKFRIPVTPGDRLE-----YHLEVLKHKGMIW---QVGGTAQVD
3d04F           F--------DPEIAKTKIVYFMTIDKVKFRIPVTPGDRLE-----YHLEVLKHKGMIW---QVGGTAQVD
3dp3D           FDPE--------IAKTKIVYFMTIDKVKFRIPVTPGDRLEY-----HLEVLKHKGMIW---QVGGTAQVD
3d04B           WG------FDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLE-----YHLEVLKHKGMIW---QVGGTAQVD
3d6xF           AFESEK---------SKVVYFTGIDGAKFRNPVRPGDRLDYESVVKNRG----------NWIFKGQAFVD
2b3mA           AVARLPG-----------TVVLLEQSFRYTSPVRIGD-----VVRVEGVVSGVEKNR---YTIVKCYTG-
3bnvA           ---------VAQASINKEFSVIIGSKCFFYAPLKLGDVLELEAHALFDE--------TSKKRDVKVVGHV
3d6xE           AFESE---------KSKVVYFTGIDGAKFRNPVRPGDRLDYESVVKNRG----------NWIFKGQAFVD
3d6xA           F-----------ESKSKVVYFTGIDGAKFRNPVRPGDRLDYESVVKNRG----------NWIFKGQAFVD
3bnvB           ---------VAQASINKEFSVIIGSKCFFYAPLKLGDVLEL-----EAHALKKRDVKV--VGHVKEIKFE
3bnvG           SI-------------NKEFSVIIGSKCFFYAPLKLGDVLELEAHALFDET--------SKKRDVKVVGHV
3bnvH           SI-------------NKEFSVIIGSKCFFYAPLKLGDVLEL-----EAHALFDETSKK---RDVKVVGHV
3bnvF           ---------VAQASINKEFSVIIGSKCFFYAPLKLGDVLELEAHALFDET--------SKKRDVKVVGHV
2b3nA           VSAAVARLPGTV--------VLLEQSFRYTSPVRIGD-----VVRVEGVVSGVEKNR---YTIVKCYTG-
3d6xB           AFESE--------PKSKVVYFTGIDGAKFRNPVRPGDRLDYESVVKNRG----------NWIFKGQAFVD
3bnvD           SI-------------NKEFSVIIGSKCFFYAPLKLGDVLEL-----EAHALFDETSKK---RDVKVVGHV
2cy9B           SITALCTEPGVSV------------DNITYSPAKIGEEIVITAHILKQGK---TLAFASVDLTNK---TT
3b7kB           ---------------WAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNN---CVEVGVRVEAFDCQEWAEGR
3d6xC           AFESPK---------SKVVYFTGIDGAKFRNPVRPGDRLDYESVVKNRG----------NWIFKGQAFVD
2e67A           ALPTPEGRALTRADYFALSHPEVRRVLA------------------------------------------


                         +         .         .         .         .         *         .:210
query           GETVLTFQSGVLEFD
2bi0A           DRLVLDFYRCALPAS
2c2iA           KPACVAE--------
3dozD           GKVVAEAELKAM---
3b7jB           GKVVAEAELKAM---
3b7jC           GKVVAEAELKAM---
3d04F           GKVVAEAELKAM---
3dp3D           GKVVAEAE-------
3d04B           GKVVAEAELKAM---
3d6xF           GNLVAEAELKAI---
2b3mA           DKVVAEGVVKVL---
3bnvA           KEIKFEGT-------
3d6xE           GNLVAEAELKAI---
3d6xA           GNLVAEAELKAI---
3bnvB           GTIQVVST-------
3bnvG           KEIKFEGT-------
3bnvH           KEIKFEGT-------
3bnvF           KEIKFEGT-------
2b3nA           DKVVAEGVVKVL---
3d6xB           GNLVAEAELKAI---
3bnvD           KEIKFEGT-------
2cy9B           GKLIAQGR-------
3b7kB           GRHINSAF-------
3d6xC           GNLVAEAE-------
2e67A           ---------------