[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK88218.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1dnkA.bssp"
#ERROR : Can't open dsspfile "1de8B.bssp"
#ERROR : Can't open dsspfile "2dnjA.bssp"
#ERROR : Can't open dsspfile "1dewA.bssp"
#ERROR : Can't open dsspfile "1dewB.bssp"
#ERROR : Can't open dsspfile "1atnD.bssp"
#ERROR : Can't open dsspfile "2a40B.bssp"
#ERROR : Can't open dsspfile "1e9nA.bssp"
#ERROR : Can't open dsspfile "2a42B.bssp"
#ERROR : Can't open dsspfile "2ddrA.bssp"
#ERROR : Can't open dsspfile "1bixA.bssp"
#ERROR : Can't open dsspfile "2ddrB.bssp"
#ERROR : Can't open dsspfile "2ei9A.bssp"
#ERROR : Can't open dsspfile "2ddsD.bssp"
#ERROR : Can't open dsspfile "2ddtB.bssp"
#ERROR : Can't open dsspfile "2ddtA.bssp"
#ERROR : Can't open dsspfile "2ddsA.bssp"
#ERROR : Can't open dsspfile "2ddrC.bssp"
#ERROR : Can't open dsspfile "1akoA.bssp"

## Summary of PDB Search
:281
    4e-16  17%  1dnkA  [d.151.1] PROTEIN (DEOXYRIBONUCLEASE I (DNASE I)
    2e-15  21%  1de8B  [d.151.1] MAJOR APURINIC/APYRIMIDINIC ENDONUCLEASE
    3e-15  17%  2dnjA  [d.151.1] DEOXYRIBONUCLEASE I
    5e-15  21%  1dewA  [d.151.1] MAJOR APURINIC/APYRIMIDINIC ENDONUCLEASE
    2e-14  19%  1dewB  [d.151.1] MAJOR APURINIC/APYRIMIDINIC ENDONUCLEASE
    7e-14  17%  1atnD  [d.151.1] DEOXYRIBONUCLEASE I
    1e-13  17%  2a40B  [x.x.x] DEOXYRIBONUCLEASE-1
    2e-13  20%  1e9nA  [d.151.1] DNA-(APURINIC OR APYRIMIDINIC SITE) LYASE
    1e-12  15%  2a42B  [x.x.x] DEOXYRIBONUCLEASE-1
    4e-12  15%  2ddrA  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    6e-12  20%  1bixA  [x.x.x] AP ENDONUCLEASE 1
    7e-12  16%  2ddrB  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    1e-11  11%  2ei9A  [x.x.x] NON-LTR RETROTRANSPOSON R1BMKS ORF2 PROTEIN
    4e-11  17%  2ddsD  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    4e-10  13%  2ddtB  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    6e-10  15%  2ddtA  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    2e-09  15%  2ddsA  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    3e-08  15%  2ddrC  [x.x.x] SPHINGOMYELIN PHOSPHODIESTERASE
    3e-08  21%  1akoA  [x.x.x] EXONUCLEASE III
:281

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxSLRDRRQRQNAAPATKDHSFPVIASYNVHKCVGRDRKFDPDRTS
1dnkA           ------------------------------------------------IAAFNIRTFGETKMSNATLASY
1de8B           --------------------------ALYEDPPDHKTSPSGKPATL-KICSWNVDGL----RAWIKKKGL
2dnjA           ------------------------------------------------IAAFNIRTFGETKMSNATLASY
1dewA           ---------------------------LYEDPPDHKTSPSGKPATL-KICSWNVDGL----RAWIKKKGL
1dewB           ---------------------------LYEDPPDHKTSPSGKPATLK-ICSWNVDGL----RAWIKKKGL
1atnD           ------------------------------------------------IAAFNIRTFGETKMSNATLASY
2a40B           ------------------------------------------------IAAFNIRTFGETKMSNATLASY
1e9nA           --------------------------ALYEDPPDQKTSPSGKPATL-KICSWNVDGL----RAWIKKKGL
2a42B           ------------------------------------------------IAAFNIRTFGETKMSNATLASY
2ddrA           ------------------------------------------------VMTHNVYLYPNWGQTERADLIG
1bixA           ---------------------------LYEDPPDQKTSPSGKPATL-KICSWNVDGL----RAWIKKKGL
2ddrB           ------------------------------------------------VMTHNVYLYPNWGQTERADLIG
2ei9A           ------------------------------------------------IGQINLGGAEDA-----TRELP
2ddsD           ------------------------------------------------VMTHNVYLYPNWGQTERADLIG
2ddtB           ------------------------------------------------VMTHNVYLYPNWGQTERADLIG
2ddtA           ------------------------------------------------VMTHNVYLYPNWGQTERADLIG
2ddsA           ------------------------------------------------VMTHNVYLYPNWGQTERADLIG
2ddrC           ------------------------------------------------VMTHNVYLYPNWGQTERADLIG
1akoA           ------------------------------------------------FVSFNINGL--RARP---HQLE


                         .         .         *         .         .         .         .:140
query           RVIQEIGADIIALQEADSRFGERTGLLDLARLERESGLVPVPVQAGVKAHGWHGNVVLFREGAVRDVHTL
1dnkA           IVRIVRRYDIVLIQEVRDSH-LVAVGKLLDYLNQDDPNTYHYVVSEPLGRYKERYLFLFRPNKVSVLDTY
1de8B           DWVKEEAPDILCLQETKCSENK-----LPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQ---CPLKVS
2dnjA           IVRIVRRYDIVLIQEVRDSHLVAVGKL-LDYLNQDDPNTYHYVVSEPLGRNSYKERYLFVSVLDTYQYDD
1dewA           DWVKEEAPDILCLQETKCSENK-----LPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGI
1dewB           DWVKEEAPDILCLQETKCSENK-----LPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQ-CPLKVSYG
1atnD           IVRIVRRYDIVLIQEVRDSH-LVAVGKLLDYLNQDDPNTYHYVVSEPLGRYKERYLFLFRPNKVSVLDTY
2a40B           IVRIVRRYDIVLIQEVRDSHLVAVGLLDYLNQDDPNTYHYVVSEPLGRNSYKERYLFLFRPNKVSDGCES
1e9nA           DWVKEEAPDILCLQETKCSENK-----LPAELQELPGLSHQYWSAPSE--GYSGVGLLSR---QCPLKVS
2a42B           IVRIVRRYDIVLIQEVRDSHLVAVGKLYLNQDDPNTYHYVVSEPLGRN-SYKERYLFLFRPNKVSVLDTY
2ddrA           AADYIKNQDVVILNEVFDNSASDRLLGNLKGRSSGSEWDKTLGNYSSSTPEDGGVAIVSKWPAEKIQYVF
1bixA           DWVKEEAPDILCLQETKCSENK-----LPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGI
2ddrB           AADYIKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTATLGNYSSSTPEDGGVAIVSKWPIAEKIQYVFA
2ei9A           SIARDLGLDIVLVQEQYSMVGFLAQCGAHPKAGVYIRNRVLPCAVLHHLSSTHITVVHIGGWDLYMVSAY
2ddsD           AADYIKNQDVVILNEVFDNS-ASDRLLGNLKKEYPNQTAVLGRSSGSEWDKTLGNYSSSTPEEKIQYVFA
2ddtB           AADYIKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAVLGRSSGSEWDKPEDGGVAIVSKWPIAEKIQY
2ddtA           AADYIKNQDVVILNEVFDNSASD----RLLGNLKKEYPNQTAVLGRSSGSEWDKTLGNYSSSTPEDGGVA
2ddsA           AADYIKNQDVVILNEVFDNSASDRLLGNLKGRSSGSEWDKTLGNYSSSTPEDGGVAIVSKWPIAEKIYVF
2ddrC           AADYIKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAVKTLGNYSSSTPEDGGVAIVSKWPIAEFAKGC
1akoA           AIVEKHQPDVIGLQETKVHDDMFPLEEV-------AKLGYNVFYHGQKGHYGVALLTKETPIAVR-RGFP


                         +         .         .         .         .         *         .:210
query           KLPGLEPRGALVVELDLKSGGTLRVIAAHFGLLRHSRAQQAKALVGLLEARNECATILMGDLNEWRLGNG
1dnkA           QYFSREPAVVKFSSHST-KVKEFAIVALHSAPSDAAEINSLYDVYLDVQQKWHLDVMLMGDFNADSSQWS
1de8B           YGIGDEEHDQEGRVIVA-EFDSFVLVTAYVLVRLEYRQRWDEAFRKFLKGLASRKPVLCGDLNVAHFGEL
2dnjA           DSFSREPAVVKFSSHST-KVKEFAIVALHSAPSDAEINSLYDVYLDVQQKWHLNDVMLMGDFNADCSYVT
1dewA           ---GDEEHDQEGRVIVA-EFDSFVLVTAYVLVRLEYRQRWDEAFRKFLKGLASRKPVLCGDLNVAHFGEL
1dewB           IGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRGLASRKPLVLCGDLNRQGFGEL
1atnD           QYDDGCCPAVVKFSSHSTKVKEFAIVALHSAPSDAVANSLYDVYLDVQQKWHLNDVMLMGDFNADCSYVT
2a40B           CGNDSFSREPAVVKFSSHSTKEFAIVALHSAPSDAVANSLYDVYLDVQQKWHLNDVMLMGDFNASQWSSI
1e9nA           YGIGDEEHDQEGRVIVA-EFDSFVLVTAYVPNAGVRLEYRQRWDEAFRKLASRKPLVLCGDLNRQGFGEL
2a42B           QYDDGNDPAVVKFSSHSTKVKEFAIVALHSAPSDAEINSLYDVYLDVQQKWHLNDVMLMGDFNADSTFQW
2ddrA           AKGCLSNKGFVYTKIKKN-DRFVHVIGTHLSPASVRTNQLKEIQDFIKNKNNNEYVLIGGDMNSEYASMF
1bixA           ---GDEEHDQEGRVIVA-EFDSFVLVTAYVGRGLVRLEYRQRWDEAFRKLASRKPLVLCGDLNRQGFGEL
2ddrB           KGCNLSNKGFVYTKIKK-NDRFVHVIGTHLQAESPASVRTNQLKEIQDFIKNKNYVLIGGDMNVNKLNAS
2ei9A           FQYSDPIDPYLHRLGNILDRLRGARVVICADTNAHSPLWHSLP-----------RHYVGRGQEVADRRAK
2ddsD           KGCNLSNKGFVYTKIKK-NDRFVHVIGTHLASVRTNQLKEIQDFIKNKNIPNNEYVLIGGDMNVNKDSEY
2ddtB           VFAKLSNKGFVYTKIKKN-DRFVHVIGTHLSPASVRTNQLKEIQDFIKNKNIPNYVLIGGDMNSYTGHTA
2ddtA           IVSKWPIKGFVYTKIKK-NDRFVHVIGTHLQAESPASVRTNQLKEIQDFIPNNEYVLIGGDMNNAENNND
2ddsA           AKGCGPNKGFVYTKIKKN-DRFVHVIGTHLQSVRTNQLKEIQDFIKNKNIPNNEYVLIGGDMNVNKASVP
2ddrC           GPDNLSNKGFVYTKIKK-NDRFVHVIGTHLDSMCGKTSPASVRTNQLKEIPNNEYVLIGGDMNVNKASVP
1akoA           GDDEEAQRRIIMAEIPSLLGN-VTVINGYFPIKFPAKAQFYQNLQNYLELKRDNPVLIMGDMNEREWMDR


                         .         .         .         +         .         .         .:280
query           SSLNTFRDAFGTLPPAVPSFPSNLPVLALDRIIANREGLIEQVEAHDSALARIASDHLPLKAAIRTxxxx
1dnkA           SIRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVAGPFDFQAAYGLSNEMALAISDHYPVEV--------
1de8B           LQAVPLADSFRHLYPNTPNARSKNVGWRLDYFLLSHS-LLPALCDSKIRSKALGSDHCPITLYLA-----
2dnjA           SIRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVAGPFDFQAAYGLSNEMALAISDHYPVEV--------
1dewA           LQAVPLADSFRHLYPNTPNARSKNVGWRLDYFLLSHS-LLPALCDSKIRSKALGSDHCPITLYLA-----
1dewB           LQAVPLADSFRHLYPNTPNARSKNVGWRLDYFLL-SHSLLPALCDSKIRSKALGSDHCPITLYLA-----
1atnD           SIRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVAGSLLQQAAYGLSNEMALAISDHYPVEV--------
2a40B           RLRTSSTFQWLIPDSADTTATSTNCAYVVPGSAAP--FDFQAAYGLSNEMALAISDHYPVEV--------
1e9nA           LQAVPLADSFRHLYPNTPNARSKNVGWRLDYFLLSHS-LLPALCDSKIRSKALGSDHCPITLYLA-----
2a42B           LIPDSADTTATSTNCAIVVAGSLLQSSVVPGSAAP--FDFQAAYGLSNEMALAISDHYPVEV--------
2ddrA           KTLNASVPSYTGHTATWDYNFPDSPAEYLDYILQPKSPQWTVTSWFQKYTYNDYSDHYPVEATIS-----
1bixA           LQAVPLADSFRHLYPNTPNARSKNVGWRLDYFLLSHS-LLPALCDSKIRSKALGSDHCPITLYLA-----
2ddrB           VPSYTGHTATWDATTNSIYNFPDSPAEYLDYIIASKD-HANPSYIENKVLYNDYSDHYPVEATIS-----
2ei9A           MEDFIGARRLVVHNADGHTFSTANGESYVDVTLSTRGVRVSEWRVTNE----SSSDHRLIVFGVGG----
2ddsD           ASMFKTLNADATTNSIAKYNFPDSPAEYLDYIIASKSPQWTVTSWFQKYTYNDYSDHYPVEATIS-----
2ddtB           TWDATTNSIAKYNFPDSPAEYLNPSYIENKVLQPK-SPQWTVTSWFQKYTYNDYSDHYPVEATIS-----
2ddtA           SEYASMFKTLATTNSIAKYNFPDSPAEYLDYIIASKDHAWTVTSWFQKYTYNDYSDHYPVEATIS-----
2ddsA           SYTGHTATWDATTNSIAKYNFPDSPAEYLDYIIASKSPQWTVTSWFQKYTYNDYSDHYPVEATIS-----
2ddrC           SYTGHTATWDATTNSIAKYNFPDSPAEYLDYIIASKSPQWTVTSWFQKYTYNDYSDHYPVEATIS-----
1akoA           LMSWGLVDTFRHANPQTADRFSDNRGLRIDLLLASQPLACVETGDYEIRSMEKPSDHAPVWATFR-----


                         .         *         .         .         .         .         +:350
query           x
1dnkA           -
1de8B           -
2dnjA           -
1dewA           -
1dewB           -
1atnD           -
2a40B           -
1e9nA           -
2a42B           -
2ddrA           -
1bixA           -
2ddrB           -
2ei9A           -
2ddsD           -
2ddtB           -
2ddtA           -
2ddsA           -
2ddrC           -
1akoA           -