[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for atum0:AAK88284.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b3mA.bssp"
#ERROR : Can't open dsspfile "3dmeA.bssp"
#ERROR : Can't open dsspfile "1c0iA.bssp"
#ERROR : Can't open dsspfile "3bhkA.bssp"
#ERROR : Can't open dsspfile "3bhfA.bssp"
#ERROR : Can't open dsspfile "1d4dA.bssp"
#ERROR : Can't open dsspfile "1d4cC.bssp"
#ERROR : Can't open dsspfile "2apgA.bssp"
#ERROR : Can't open dsspfile "3djeB.bssp"
#ERROR : Can't open dsspfile "2ardA.bssp"
#ERROR : Can't open dsspfile "3c4nA.bssp"
#ERROR : Can't open dsspfile "3djeA.bssp"
#ERROR : Can't open dsspfile "1d4cA.bssp"
#ERROR : Can't open dsspfile "2bxrA.bssp"
#ERROR : Can't open dsspfile "3djdB.bssp"
#ERROR : Can't open dsspfile "2b9wA.bssp"
#ERROR : Can't open dsspfile "3djdA.bssp"
#ERROR : Can't open dsspfile "2bs2A.bssp"
#ERROR : Can't open dsspfile "3cukA.bssp"
#ERROR : Can't open dsspfile "1d4cB.bssp"
#ERROR : Can't open dsspfile "3cp2A.bssp"
#ERROR : Can't open dsspfile "2e4gB.bssp"
#ERROR : Can't open dsspfile "2e4gA.bssp"
#ERROR : Can't open dsspfile "2bi7A.bssp"
#ERROR : Can't open dsspfile "3da1A.bssp"

## Summary of PDB Search
:427
    3e-29  16%  1b3mA  [x.x.x] MONOMERIC SARCOSINE OXIDASE
    2e-25  15%  3dmeA  [x.x.x] CONSERVED EXPORTED PROTEIN
    7e-25  13%  1c0iA  [c.4.1 - d.16.1] D-AMINO ACID OXIDASE
    2e-24  16%  3bhkA  [x.x.x] MONOMERIC SARCOSINE OXIDASE
    3e-23  16%  3bhfA  [x.x.x] MONOMERIC SARCOSINE OXIDASE
    6e-18  15%  1d4dA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    6e-17  14%  1d4cC  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    1e-16  11%  2apgA  [x.x.x] TRYPTOPHAN HALOGENASE PRNA
    5e-16  12%  3djeB  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    6e-16  10%  2ardA  [x.x.x] TRYPTOPHAN HALOGENASE PRNA
    8e-16  14%  3c4nA  [x.x.x] UNCHARACTERIZED PROTEIN DR_0571
    2e-15  13%  3djeA  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    8e-15  18%  1d4cA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    4e-14  12%  2bxrA  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] A
    7e-13  14%  3djdB  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    5e-11   6%  2b9wA  [x.x.x] PUTATIVE AMINOOXIDASE
    1e-10  13%  3djdA  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    3e-10  12%  2bs2A  [c.3.1 - d.168.1 - a.7.3 (1e7pA)] QUINOL-FUMARATE REDUCTASE
    3e-09  12%  3cukA  [x.x.x] D-AMINO-ACID OXIDASE
    2e-08  22%  1d4cB  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    6e-08  12%  3cp2A  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    2e-07  10%  2e4gB  [x.x.x] TRYPTOPHAN HALOGENASE
    2e-06  10%  2e4gA  [x.x.x] TRYPTOPHAN HALOGENASE
    2e-05   7%  2bi7A  [x.x.x] UDP-GALACTOPYRANOSE MUTASE
    2e-05  11%  3da1A  [x.x.x] GLYCEROL-3-PHOSPHATE DEHYDROGENASE
:427

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFTGQSAALHLAEGGLDVILLEAKEIGFGGAGR
1b3mA           ----------------------------------------GMAAGYQLAKQGVKTLLVDAFDPPHTNGSH
3dmeA           ----------------------------------------GLAIARALAAGGHEVLVAEAEGIGTGTSSR
1c0iA           ----------------------------------------GLSSALILARKGYSVHILARDLPEDVSSQT
3bhkA           ----------------------------------------GMAAGYQLAKQGVKTLLVDAFDPPHTNGSH
3bhfA           ----------------------------------------GMAAGYQLAKQGVKTLLVDAFDPPHTNGSH
1d4dA           ----------------------------------------GLAAAVSARDAGAKVILLEKEPIPGGNTKL
1d4cC           ----------------------------------------GLAAAVSARDAGAKVILLEKEPIPGGNTKL
2apgA           --------------------------------------TAGWMAASYLVRALQQITLIESA--AIPRIGV
3djeB           --------------------------------------TWGTSTALHLARRGYTNVTVLDPYPVPSAISA
2ardA           ----------------------------------------GWMAASYLVRALQQANITLIESAAIPRIGV
3c4nA           --------------------------------------RGAACAFYLRQLAPGRSLLLVEEGGLPNEEGA
3djeA           --------------------------------------TWGTSTALHLARRGYTNVTVLDPYPVPSAISA
1d4cA           ----------------------------------------GLAAAVSARDAGAKVILLEKEPIPGGNTKL
2bxrA           ---------------------------------------SGLSAAKLLTEYGVSVLVLEARDRVGGRTGA
3djdB           ---------------------------------------WGTSTALHLARRGYTNVTVLDPYPVPSAISA
2b9wA           ----------------------------------------------------------------------
3djdA           ----------------------------------------------------------------------
2bs2A           ----------------------------------------GLRAAVATQQKGLSTIVLSLIPVKRSHSAA
3cukA           --------------------------------------VIGLSTALCIHERYHSVLQPLIKVYADRFTPL
1d4cB           ----------------------------------------GLAAAVSARDAGAKVILLEKEPIPGGNTKL
3cp2A           ----------------------------------------------------------------------
2e4gB           --------------------------------------TAGWMAASYLGKALQGTTLLQAPDIPTLGVGE
2e4gA           --------------------------------------TAGWMAASYLGKALQGTADITLQAPDIPTLGV
2bi7A           ----------------------------------------------------------------------
3da1A           ---------------------------------------TGAGIALDAQVRGIQTGLVENDF-ASGTSSR


                         .         .         *         .         .         .         .:140
query           NVGLINGGMWVMPKELPDVLGETYGERLLDLLGDAPVLVRELVEKHGIPCEIEKNGTLHCAVGEKGLAEI
1b3mA           HGDTRIIRHAYGEGREYVPLALRSQELWYELEKETHHKIFT-------------KTGVLVFGPKGESAFV
3dmeA           NSEVIHAG-----------IYYPADSLKARLCVRGKHLLYEYCAARGVPHQ--RLGKLIVATSDAEASQL
1c0iA           FASPWAGANWTP---------FMTLTDGPRQAKWEESTFKKWVELVPTGHAMWLKGTRRFAQNEDGLLGH
3bhkA           HGDTKIIRHA-------------YGEGREYVPLALRSQELWYELEKETHHKIFTKTGVLVFGPKGESAFV
3bhfA           HGDTKIIRHAYGEGREYVPLALRSQELWYEL-------------EKETHHKIFTKTGVLVFGPKGESAFV
1d4dA           AAGGMNAAETKPQAKLGIEDKKQIMID--------------DTMKGGRNINDPELVKVLANNSSDSIDWL
1d4cC           AAGGMNAAET--------------KPQAKLGIEDKKQIMIDDTMKGGRNINDPELVKVLANNSSDSIDWL
2apgA           GEATIPSLQKVFFDFLGIPEREWMPQGAFKAAIKFVNWRKSPDPSRDDHFYHLFGNVPNCDGVPLTHYWL
3djeB           GNDVNKVISSGQYSNNKDEIEVNEILAEEAFNGWKNDPLFKPYYHDTGLLSACSQE----GLDRLGVRVR
2ardA           GEATIPSLQKVFFDFLGIREWMPQVNGAFKAAIKFVNWRKSPDPSRDDHFYHLFGNVPNCDGVPLTHYWL
3c4nA           T---ILAPGVWTAQDIPAGQEAQAEWTREQLLGALGSGKTLEVEDRPLLHLLPAGEGSGLTPTLDALADF
3djeA           GNDVNKVISSGQYSNNKDEIEVNEILAEEAF--------NGWKNDPLFKPYYHDTGLLSACSQEGLDRLG
1d4cA           AAGGMNAAE-------------TKPQAKL--------GIEDKKQIMIDDTMKGGRNINDPELVKVLANNS
2bxrA           YVGPTQNRILRLSKELGIETYKVNVSNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKT
3djdB           GNDVNKVISSIEVNEIL-----------------AEEAFNGWKNDPLFKPYYHDTGLLSACSQE------
2b9wA           ----------------------------------------------------------DEFLALNGCEAA
3djdA           ---------------------------------------------PLFKPYYHDTGLLSACSQEGLDRLE
2bs2A           AQGGMQASLGNSKMSDGDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKA--------------------
3cukA           TTTDVAAGLWQPYLPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNL--------------------
1d4cB           AAGGMNAAETKP--------------QAKLGIEDKKQIMIDDTMKGGRNINDPELVKVLANNSS------
3cp2A           -----------------------------------------LLTHNIDTLGQ------MSCNPAIGGIGK
2e4gB           ATIPNLQTAFFDFLGIPEDEWMRECNASYKVAIKFINWRTAGEGTSEARELDGGPDHFYHSFGLLKYHEQ
2e4gA           GEATIPNLQTAFFDFLPEDEWMRECNASYKVAIKFINWRTAGEGTSEARELDGGPDHFYHSFGLLKYHEQ
2bi7A           ----------------------------------------------------------------------
3da1A           STKLVHGVGKER---------------------------------------------------AIVYENA


                         +         .         .         .         .         *         .:210
query           RERCEQWSARGAPVRVLDADETASYIGSTAYSGALLDSRAGTIQPLAYVRGLAGAALKAGVRLHTASPVN
1b3mA           AETMEAAKEHSLTVDLLEGDEINPGITVPENYNAIFEPNSGVLFSENCIRAYRELAEARGAKVLTHTRVE
3dmeA           DSIARRAGANGVDLQHIDGAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDAESDGAQLVFHTPLI
1c0iA           WYKD-----ITPNYRPLPSSECPPG-------AIGVTYDTLSVHAPKYCQYLARELQKLGATFER-----
3bhkA           AETMEAAKEHSLTVDLLEGDEINKRITVPENYNAIFEPNSGVLFSENCIRAYRELAEARGAKVLTHTRVE
3bhfA           AETMEAAKEHSLTVDLLEGDEINKGITVPENYNAIFEPNSGVLFSENCIRAYRELAEARGAKVLTHTRVE
1d4dA           TSMGADM-------TDVGRMGGASVNRSHRPTGG-----AGVGAHVAQV--LWDNAVKRGTDIRLNSRVV
1d4cC           TSMGADMT------DVGRMGGASVNRSHRPTGGAGVGAHVAQV--------LWDNAVKRGTDIRLNSRVV
2apgA           RKREQGFQQPMEYACYPQPGALDGKLAPCLSDGTRQMSHAWHFDAHLVADFLKRWAVERGVNRVVDEVVD
3djeB           PGEDPNLVELTRPEQFRKLAPEGVLQGDFPGWKGYFARSGAGWAHARNALVAAAREAQRGVKFVTGTPQG
2ardA           RKREQGFQQPMEYACYPQPGALDGKLAPCLSDGTRQMSHAWHFDAHLVADFLKRWAVERGVNRVVDEVVD
3c4nA           PEALALLDPARLPVARVDPRALTYRPGSLA----LLAAQQAIGQGAGLLLNTRAELVPGGVRLHRLTVVH
3djeA           VRVRPGEDPNLVELTRPEQFRKLAPQGDFPGWKGYFARSGAGW---AHARNLVAAAREAGVKFVTGTPQG
1d4cA           SDSIDWLTSMGADMTDVGRMGGASVNRSHRPTGG-----AGVGAHVAQV--LWDNAVKRGTDIRLNSRVV
2bxrA           ARRFAVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVGQERKFVGGSGQVSERIMDLLGDQVKLNHPVT
3djdB           GLDRLNLVELTRPEQFRKLAPEGVLQGDFPGWKGYFARSGAGWAHARNALVAAAREAQRGVKFVTGTPQG
2b9wA           RDLWINPFTAFGYGHFDNVPAAYVLKYLDFVTMMSFAKGDLWTWADGTQAMFEHLNATLEHPAERNVDIT
3djdA           DPNLVELTRPEQFRKLAPEGVLQ---GDFPGWKGYFARSGAGWAHARNALVAAAREAQRGVKFVTGTPQG
2bs2A           ----------------------------------------------------------------------
3cukA           -FHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVES
1d4cB           -DSIDWLTSMGADMTDVGRMGGASVNRSHRPTGG-----AGVGAHVAQV--LWDNAVKRGTDIRLNSRVD
3cp2A           GHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMIFQQAVE
2e4gB           IPLRGKTVEPFDYACYKEPVILDANRSPRRLDGSKVTNYAWHFDAHLVADFLRRFATEKLGVRHVVEHVQ
2e4gA           IPKTVEPFDYACYKEPVILDANRSPRRLDGSKVTNYAWHFDAHLVADFLRRFATEKLGVRHVEDRVEHVQ
2bi7A           ----------------------------------------------------------------------
3da1A           PHVTTPEWLLPIFKRYLNEKQTLEKEPLLRKENGGGIYVEYRTDDARLTLEIKEAVARGAVALNYKVESG


                         .         .         .         +         .         .         .:280
query           ETGRNGAKWVVKTPEGSVTAKWIVVATEAYSTGPWQIIREEQVYLPYFNFATRPLSDNLQKSILPGRQGC
1b3mA           DFDISPDSVKIETANGSYTADKLIVSMGAWNSLSKLNLDIPQLPYRQVVGFFESDESKYSNDIDFPGFMV
3dmeA           AGRVRPEGGFGGAEPMTLSCRVLINAAGLHAPARRIEGIPRDSIPPEYLCKGSYFTLAGRAPFSRLIYPV
1c0iA           -------RTVTSLEQAFDGADLVVNATGLGAKSIAGIDDQAAEPIRGQTVLVKSPCKRCTMDSSDPASPA
3bhkA           DFDISPDSVKIETANGSYTADKLIVSMGAWNSLSKLNLDIPLQPYRQVVGFFESDESKYSNDIDFPGFMV
3bhfA           DFDISPDSVKIETANGSYTADKLIVSMGAWNSLSKLNLDIPLQPYRQVVGFFESDESKYSNDIDFPGFMV
1d4dA           RILEDGKVTGVYTGYYVIKADAVVIAAGGFAKNNERVSKYDPKLKGFKATNHPGATGDGLDVALQAGAAT
1d4cC           RILEDASGKVTYTGYYVIKADAVVIAAGGFAKNNERVSKYDPKLKGFKATNHPGATGDGLDVALQAGAAT
2apgA           VRLNNGYISNLLTKEGRTLEADLFIDCSGMRGLLINQALKEPFIDMSDYLLCDSAVASAVPNDDARDGVE
3djeB           LIFENNDVKGAVTADGKIRAERTFLCAGASAGQFLDFKNQLRPTAWTLVHIALKPEERALYKNIPVI---
2ardA           RLNNRGYISNLLTKEGRTLEADLFIDCSGMRGLLINQALKEPFIDMSDYLLCDSAVASAVPNDDARDGVE
3c4nA           ETRQQGLGLHTRHGRAYRQFPRLDLLSGAQTPVLR-----------------ASGLTLRPQNGGYTLVPA
3djeA           RIFENNDVKGAVTADGKIRAERTFLCAGASAGQFLDFKNQLRPTAWTLVHIALKPEERALYKNIPV---I
1d4cA           RILEDASGKVTYTGYYVIKADAVVIAAGGFAKNNERVSKYDPKLKGFKATNHPGATGDGLDVALQAGAAT
2bxrA           HVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPALPMGAVIKCMMYYKEAFWKKKDYCGC
3djdB           IFENNDVKGAVTADGKIWRAERTFLCAGASAGQLDFKNQLRPTAWTLVHIALKPE----ERALYKNIPVI
2b9wA           RITREDGKVHIHTTDWDRESDVLVLTVPLEKFLDYSDADDDEREYFSKIIHQQYMVDACLVKEYPTISGY
3djdA           RFENNDVKGAVTADGKIWRAERTFLCAGASAPTAWTLVHIALKPEERALYKNIPVIFNIERGFFFEPDEE
2bs2A           ----------------------------------------------------------------------
3cukA           FEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWM---------------KHFILTHDPER
1d4cB           ASGKTGVLKGEYTGYYVIKADAVVIAAGGFAK--------------------------------------
3cp2A           DVENDRVVGAVTQMGLKFRAKAVVLTVGTFIPLPLRVGRLKTGTPPRIDARTIGDNPMPVFSFMGNASQH
2e4gB           RDANGNIESVRTATGRVFDADLFVDCSGFRGLLINKAMEEPFLDMSDHLLNDSAVATQVPHDDDANGVEP
2e4gA           RDANGNIESVRTATGRVFDADLFVDCSGFRGLLINKAMEEPFLDMSDHLLNDSAVATQVPHDDDANGVEP
2bi7A           --------GYTQMIKSILNHENIKVDLQREFIVEERTHYDHVFYSGPLDAFYGYQYGRLGYRTLDFKKFT
3da1A           KVVGVVAKDRLTDTTHTIYAKKVVNAAGPWVDTLREKDRSKHGKYLKLSKGVHLVVDQSRFPLRQAVYFD


                         .         *         .         .         .         .         +:350
query           WDTKEILSSFRMDKAGRLVFGSVGALRGTGTAIHRAWAKRSLKRLFPQLGDTEFECEWYGQIGMTDNAVP
1b3mA           EVPNGIYYGFPSFGGCGLKLGYHTFGQKGVYPEDESNLRAFLEEYMPGA-NGELKRGAVCMYTKTLDEHF
3dmeA           PQHAGLGVHLTLDLGGQAKFGPDTEWIATLDPRRADVFYAAVRSYWPALPDGALAPGYSGPHEPAADFAI
1c0iA           YIIPRPGGEVICGGTYGVGDWDLSVNPETVQRIKHCLRLDPTISSDGTIEGIEVLRHNVGLRPARRG---
3bhkA           EVPNGIYYGFPSFGGCGLKLPDTINREFGVYPEDESNLRAFLEEYMPGA-NGELKRGAVCMYTKTLDEHF
3bhfA           EVPNGIYYGFPSFGGCGLKLGYHTFGQKGVYPEDESNLRAFLEEYMPGA-NGELKRGAVCMYTKTLDEHF
1d4dA           RDLQYIQAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFMNEITTRDKASAALQQKGESAYLVFDDSIRK
1d4cC           RDLEYIQAHPTYSPAGGVMITGNGAIVVNREGNRFMNEITTRDKASAAILQQKGESAYLVFDDSIRKSLK
2apgA           PYTSSIAMNSGWTWKIPMLGRFGSGYVFSSHFTSRDQATADFLKLWGLSDNQPLNQIKFRVGRNKRAWVN
3djeB           FNIERGFFFEPDEERGEIKICDEHPGYTNVQSADGETRVRALLKETPQLADRPFSFARICWCADTANREF
2ardA           PYTSSIAMNSGWTWKIPMLGRFGSGYVFSSHFTSRDQATADFLKLWGLSDNQPLNQIKFRVGRNKRAWVN
3c4nA           IHHRDPHGYHPAGGSLTGVPTGLRRELLEDLVGLDAVPALAGEGLELGRSSADVPGAWLALPGGRPDAPP
3djeA           FNIERGFFFEPDEERGEIKICDEHPGYTNVIPKEAETRVRALLKETPQLADRPFSFARICWCADTANREF
1d4cA           RDLEYIQAHPTYSPAGGVMI--TEAVRGNGAIVVNREGNRFMNEITT-----------------------
2bxrA           MIIEDEDAPISITLDDTKPDGSLPAIMGILARKADRLAKLHYAKVLGSQEA----LHPVHYEEKNWCEEQ
3djdB           FNIERGFFFEPDEERGEIKICDEHPFEKTQIPKEAETRVRALLKETPQLADRPFSFARICWCADTANREF
2b9wA           VGHVMVYYHRWADDPHQIITTYLLRNHPDYADKTQQMVLDDMETFGHPVEKIIEEQTWYYFPHVSSEDYK
3djdA           RGEIKICDEHPGYTNVQSADGTSIPFEKTQIPKEAETRVRALLKETPQLADRPFSFARICWCADTANREF
2bs2A           ----------------------------------------------------------------------
3cukA           GIYNSPYIIPGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRL
1d4cB           ----------------------------------------------------------------------
3cp2A           PQQVPCYITHTNDRNQHQIFLEPEGLTSNEIYPNGISTSLPIVRSMQGMENAKIVRPGYAIEYDFFDPRD
2e4gB           FTSAIAMKSGWTWKIPMLGRFGTGYVYSSRFATEDEAVREFCEMWDPETQPLN---RIRFRVGRNRRAWG
2e4gA           FTSAIAMKSGW-----TWKIPMLGRFGTGYVYSSRFATEDEAVREFCEMWHLDPETQPLNRIRFRVGRNR
2bi7A           YQGDYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDVCYKEYSRACEENDIPYYPIRQMGEMALLEKYLS
3da1A           TESDGRIFAIPREGKTYIGTTDTFYDKDIASPRTVEDRDYILAAANYFPSLTADDVESSWAGLRPLIHED


                         .         .         .         .         *         .         .:420
query           RFHKFAENVIGFSGYNGRGIAPGTAFGKVIAQHILGEIAEADLPLPVTEPKAQAFRAVKEAYYEAGAQIA
1b3mA           IIDLHPENVVIAAGFSGHGFKFSSGVGEVLSQLALTGKTEHDI---------------------------
3dmeA           AGPASHGGLVNLYGIESPGLTASLAIAEETLARL------------------------------------
1c0iA           GPRVEAERIVLPLDRTKSPLSLGRGSARAAKEKEVTLVHAYGFS----SAGYQQSWGAAED---------
3bhkA           IIDLHPENVVIAAGFSGHGFKFSSGVGEVLSQLALTGKTEHDI---------------------------
3bhfA           IIDLHPENVVIAAGFSGHGFKFSSGVGEVLSQLALTGKTEHDI---------------------------
1d4dA           SLKAIEGYVHLNIVKEGKTIEELAKQIDVPAAELAKTV--------------------------------
1d4cC           AIEGYVHLNIVKEGKTIEELA-------------------------------------------------
2apgA           NCVSIGLSSCFLEPLESTGIYFIYAALYQLVKHFPDTSFDPRL---------------------------
3djeB           LIHPQYHSLVLGCGASGRGFKYLPSIGNLIVDAEGKVPQKIHELIKWNPDIAANRNWRDTLGRFGGPNRV
2ardA           NCVSIGLSSCFLEPLESTGIYFIYAALYQLVKHFPDTSFDPRLSDAFNAHMFDDCRDFVQAHYF------
3c4nA           QAEELA----------------------------------------------------------------
3djeA           LIHPQYHSLVLGCGASGRGFKYLPSIGNLIVDAEGKVPQKIHELIKWNPDIAANRNWRDTLGRFGGPNRV
1d4cA           ----------------------------------------------------------------------
2bxrA           YSGGCYTAYFPPGIMTQYGRVIRQPVGRI-----------------------------------------
3djdB           LIHPQYHSLVLGCGASGRGFKYLPSIGNLIVDAEGKV---------------------------------
2b9wA           AGWYEKVEGTFYAGMSFGNFDEVCHYSKDLVTRF------------------------------------
3djdA           LIHPQYHSLVLGCGASGRGFKYLPSIGNLIVDAEGKV---------------------------------
2bs2A           ----------------------------------------------------------------------
3cukA           EREQLNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEE------------------------------
1d4cB           ----------------------------------------------------------------------
3cp2A           LKPTLESKFIQGLFFAG-QINGTTGYEEAAAQGLLAGLNAARLSAGWAPARSQAYLGV------------
2e4gB           NCVSIGTSSCFVEPLESTGIYFVYAALYQLVKHFPDKSLNPVL---------------------------
2e4gA           RAWVGNCVSIGVEPLESTGIYFVYAALYQLVKHFPKSLNPVLT---------------------------
2bi7A           LAENETNFVGRLGTYRYLDMDVTIAEALKTAEVYLNS---------------------------------
3da1A           EIFFSDSGLISIAGGKLTGYRKAERTVDAVAQGLNVNEPCTTA---------------------------


                         .         .         +         .         .         .         .:490
query           HFAxxxx
1b3mA           -------
3dmeA           -------
1c0iA           -------
3bhkA           -------
3bhfA           -------
1d4dA           -------
1d4cC           -------
2apgA           -------
3djeB           DFH----
2ardA           -------
3c4nA           -------
3djeA           DFH----
1d4cA           -------
2bxrA           -------
3djdB           -------
2b9wA           -------
3djdA           -------
2bs2A           -------
3cukA           -------
1d4cB           -------
3cp2A           -------
2e4gB           -------
2e4gA           -------
2bi7A           -------
3da1A           -------