[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK85845.1

[Show Plain Result]


## Summary of Sequence Search
    1::298
   28::221     2e-31  42%  454 aa  PF01039 Carboxyl_trans "Carboxyl transferase domain"
    1::298

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01039         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxRLRDSRAKTEQEDTILAGVGLLKGLKIVAVVHEFQFMAGSLGIA
PF01039         --------------------------RLTEFGRKKGPGDGVVTGIGTINGRPVVVAAQDFTFMGGSMGPV


                         +         .         .         .         .         *         .:210
query           AGEAIVKAFERAISERCPLVMFPASGGARMQEGILSLMQLPRTTVAVNMLKEAGMPYIVVLTNPTTGGVT
PF01039         VGEKITRAIELALENGLPLIILVDSGGARMQEGVLSLMQMAKIFAALARL-SGGIPQISVVTGPTTGG-G


                         .         .         .         +         .         .         .:280
query           ASYAMLGDVHIAEPGAEICFAGKRVIEQTIREKLPEGFQTSEYLLEHGMVDMVIDRREIPDTLASMLKIM
PF01039         AYFPALGDIIIAVPGALIGLAGPRVIEQTTGEEV-----TSEHMRKSGVADLVAE--DEAEALALARRLL


                         .         *         .         .         .         .         +:350
query           TKAPADNANAVVPxxxxx
PF01039         SYLPG-NPPPIVP-----