[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK85915.1

[Show Plain Result]


## Summary of Sequence Search
    1::107
    3::90      1e-16  53%   93 aa  PF02575 DUF149 "Uncharacterised BCR, YbaB family COG0718"
    1::107

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxKVKEMQSKMEKVQQEIAALEIEGRAGGGLVTVILNGKGEMRGLKIDPSLFKEDEVEILEDL
PF02575         ---------QAQKMQEKMQKAQEELAEKEVEGESGGGLVTVTVNGKGEVKSVEIDPSLLDPEDKEMLEDL


                         .         .         *         .         .         .         .:140
query           IVAAHKDAKEKGEAQAQEKMADLTAGLxxxxxxxxxx
PF02575         ILAAVNDALRKAEELSKEKMGKLTGGL----------