[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK85965.2

[Show Plain Result]


## Summary of Sequence Search
    1::1782
    1::342     8e-76  48%  342 aa  PF01645 Glu_synthase "Conserved region in glutamate synthase"
    3::282     2e-37  33%  288 aa  PF04898 Glu_syn_central "Glutamate synthase central domain"
   20::181     4e-30  45%  195 aa  PF01493 GXGXG "GXGXG motif"
    5::172     1e-20  45%  175 aa  PF00310 GATase_2 "Glutamine amidotransferases class-II"
   87::285     9e-09  28%  342 aa  PF01645 Glu_synthase "Conserved region in glutamate synthase"(query 449->630)
    1::1782

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxVLKGRLNSQEVMPYFCDLTDPRHKVHTMYFHTRFSTNTDPHPSMAQPFRLMAHNGELNTDKKNRLSEA
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         --VYKGLLTEQLAEYY---LQDERLKSYLAIGHTRFSTNGFPSWENAHPFRALAHNGEINNYRGNRWLEA
PF01645         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AVALAKNASIVRPKGQSDSCRLDQTLQARVMEDGLDLVTAVVSMMPPAWENDDTLSPGVKSMLEYFSLYE
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         RGYLFKSGS--------DSEVLDNLLEL-LLRGGRSLEEAVM-MLP----EDPNMDPEERAFYEYHRCLM
PF01645         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EKNDGPAALIFGDGTIIGARLDRLGLRPLRTVETDDYLCVMSxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         EPWDGPAAIVFTDGRKVGAVLDRNGLRPLRYGITKDGLVVLA----------------------------
PF01645         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQRYVAYSHNQESFK
PF01645         ----------------------------------------------------------------------
PF04898         --------------------------------------------------------KRQKAFGYTYEDLN
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FLMDPMLASGAEKISAMGYGNAINALSDQEGGVAKYFSQRFAQVTNPPLDSIREADGMTLRVALGAKPNS
PF01645         ----------------------------------------------------------------------
PF04898         MILEPMAKTGKEPIGSMGDDTPLAVLSEKPRLLYDYFKQLFAQVTNPPIDPIREEIVMSLRTYLGPEGNE
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------KDGAIKQVASGRFGVTP----EYLVNADAIEIKIAQGAKPGE


                         *         .         .         .         .         +         .:560
query           GAKKARQIVVRSPILTHLDMLRIREQPETPVRRFEMLYTPVFDAEDANEAALRQAIDGLCGEVVAFAAEE
PF01645         ----------------------------------------------------------------------
PF04898         TPENAHRLELDSPILSNLEKLRNLDDPGFKAKTLDI----TFDVAEGSEG-LEAALDRLCAEAEEAVRDG
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         GGKVTEEIAKLRGSPPGVDL--ISPPPHHDIYSIEDLAQLIYDLKEANPGAVKLVAEHGVGTIAAGVAKA


                         .         .         .         *         .         .         .:630
query           GGIAVVTDRHVSAGRAALPMIMVVSAINQRLIEEGLRLRISLIVESGQFSSSHHIAAGLGFGASAVYPLG
PF01645         ----------------------------------------------------------------------
PF04898         AQILILSDRNVSEDRVPIPSLLAVGAVHHHLVRKGLRTKVSLVVETGEAREVHHFAVLLGYGADAINPLR
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         GADFITIDGHSSIKHAGLPWELGLAEAHQTLVENGLRDRVRLIADGGLRTGRDVAKAAVGFGTAAMIALG


                         .         +         .         .         .         .         *:700
query           VQFRAEXXXXXXXXXXXXXXXXXXXXSLMKTMGKVGLCTAESYIGGEFFExxxxxxxxxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------
PF04898         DLIDEGLLADLSYEEAIKNYRKAINKGLLKIMSKMGISTLASYRGAQIFE--------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxEGGALMVQAKGEAFAYMSLIRTAPNSIPLETVQKASEITKTLASGAMSXXXXXXXXXXXXXX
PF01645         --------EGGTVV--APGRVATTLGLLEFKEDEIPIEEVEPPEEIVKRFNISAMSFGALSPEAHEALAI
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           XTNMVGGMSNSGEGGEHISRYGTIRASRIKQFASGRFGVWAGYLADPMLEEIEIKIGQGAKPGEGGQLPS
PF01645         AANRLGGKSNTGEGGEDPERLGTGKDGAIKQVASGRFGVTPEYLVNA--DAIEIKIAQGAKPGEGGQLPG
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           PKVTVEIAAARGGTPGVELVSPPPHHDTYSIEDLAQLIHDAKAARVRVIVKLVSSEGIGTIAVGVAKAGA
PF01645         HKVTEEIAKLRGSPPGVDLISPPPHHDIYSIEDLAQLIYDLKEANAPVGVKLVAEHGVGTIAAGVAKAGA
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           DVIXXXXXXXXXXXXXXXSLKYTGRAAEIGIAEVHQALCATGLRAKVLLRCSGAHQTASDVVKSALLGGD
PF01645         DFITIDGHDGGTGAAPLSSIKHAGLPWELGLAEAHQTLVENGLRDRVRLIADGGLRTGRDVAKAAALGAD
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           SFEFGTTALMMLKCVMAKNCNIKCPAGLTTNQEAFNGDPRALAQYLMNIAHETREILAGLGLRxxxxxxx
PF01645         EVGFGTAAMIALGCIMARKCHLNCPVGVATQDPEFEGKPERVVNYFRFLAEELREILAALGVR-------
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRRFLEAGSVRIDTSGSAGQSFGAFCNDGM
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         -----------------------------------------KRYGEGGTIEVTLKGSAGQSFGAFLAGGL
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           IMVHTGTCNDGVGKSACGGTIVVRSPGGGSKETGGNVLVGNFALFGATGGRTFVEGQAGDRFAVRNSGAT
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         TIEVEGDANDYVGKGMSGGKIVVRGNAGDGGKAEVNGIVGNTCLYGATGGKLFVRGNAGERFGVRNSGAT
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           AVVEGVGDFACEYMTNGAVXXXXXXXXXXXXXXXXXFVYQYDPYGDLPKKVSHDSILLxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         IVVEGAGDHGGEYMTGGRVVVLGDTGRNFGAGMSGGVIYVRGEVGGLPKRVNPELVEL------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         ----------------------------------------------------------------------
PF04898         ----------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------
PF00310         ----------------------------------------------------------------------
PF01645         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01645         --------------------------------
PF04898         --------------------------------
PF01493         --------------------------------
PF00310         --------------------------------
PF01645         --------------------------------