[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK86001.1

[Show Plain Result]


## Summary of Sequence Search
    1::153
    1::146     1e-29  49%  146 aa  PF06754 PhnG "Phosphonate metabolism protein PhnG"
    1::153

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxNIDSERKRVAALLARATVQELETVWSRQDASPQTENVRGPETGLVMVKGRIGGGGAPFNLGETT
PF06754         ------SLHAARQDWMAVLAKAPRDELEAALDALLDAPAYDWLRAPEIGLVMVRGRIGGTGDPFNLGEAT


                         .         .         *         .         .         .         .:140
query           VTRATVKLASGTVGHAHVLGTGRKKAWYAAVFDALWQESQTRGFIEAELLSPVEKRLSEEKQRKTKETAA
PF06754         VTRAAVRLRDGTVGYAYVLGRDKRHAELAALADALLQTPERHERLRAALIEPLAARLAARRAARAAEAAA


                         +         .         .         .         .         *         .:210
query           TRVDFFTMVRGEx
PF06754         TRVDFFTMVRGE-