[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK86109.1

[Show Plain Result]


## Summary of Sequence Search
    1::268
    2::247     6e-31  40%  254 aa  PF02673 BacA "Bacitracin resistance protein BacA"
    1::268

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxALLLGIIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNTFXXXXXXXXXXXXXXVYFQKLVSIA
PF02673         --------AIILGIVQGLTEFLPVSSTGHLILVPHLLGLDGDFGLAFDVVIQLGTILAVLVYFRKLLRLL


                         .         .         *         .         .         .         .:140
query           VAMPTSXXXXXXXXXXXXXXXXXXXIGALAHDFIKTVLFETPMLICVVLIIGGFILLAVDRMPLKPKYTD
PF02673         RGLFRSERTADRRLAWLIIIATIPALGLLFKDFIEELL-RNPLVVAIALIVGGILLILAERLRRR-RVKD


                         +         .         .         .         .         *         .:210
query           IMDYPPSLAFKIGLFQCLAMIPGTSRSGATIVGALLMGTDKRSAAEFSFFLAMPTMLGAFVLDLYKNRDA
PF02673         LDDLTYKDALIIGLAQALALIPGTSRSGATISGGLLLGLSREAAAEFSFLLAIPAMLGAGLLKLLKLFEA


                         .         .         .         +         .         .         .:280
query           LSFDDSALIAVGFVAAFVSGLFVVRSLLDFVSRRGFAPFAWWRxxxxxxxxxxxxxxx
PF02673         LSAGDLGPLLVGFVVAFIVAYLAIKWLLRYLKRHSFKPFAIYR---------------