[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK86181.1

[Show Plain Result]


## Summary of Sequence Search
    1::299
    4::289     1e-19  37%  295 aa  PF00294 PfkB "pfkB family carbohydrate kinase"
    1::299

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxVFGSINMDLVATAKRLPKPGETVTGDTFSTAAGGKGANQALAARRAGVTVKMAGATGDDTFAAPALT
PF00294         ---VIGEVMIDLVPTVDR----GETVRASSFEQSPGGAGANVAVALARLGARVALVGAVGDDEFGRFLLD


                         .         .         *         .         .         .         .:140
query           LLRDAGTDLSLVKTAPGPTGTAVILIGEGGENMISVIPAANGEVSAFDATKVVGEMDAGDILMLQFEIPX
PF00294         ELEAEGVDTSGVRVDPGPTGVALILVDGDGERTIVIYRGANADLTPEELAD--EDLLAGDILHLSGLLPL


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXKRITTVINTAPLTADGPRLAGLADIVIANETEFELLIGKNGLSSGERESELKALHDRT
PF00294         PEATLEAAIEAAKAGGDPNLRDPLWADARELLPYVDILKPNEEEAEALTGAEGEDPEEALAALRKLLEKG


                         .         .         .         +         .         .         .:280
query           GQTLIVTLGADGVIAMRNGKVFSASGLKIEPVDTVGAGDTFCGYLAASLDQGMDFEKALKRAAVAGSLAC
PF00294         VKIVVVTLGADGLLYTGDGEYHVPAVPPVEVVDTTGAGDAFVAGLLAGLLAGKSLEEALRFANAAAALVV


                         .         *         .         .         .         .         +:350
query           TRAGAQxxxxxxxxxxxxx
PF00294         TRPGAR-------------