[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK86197.1

[Show Plain Result]


## Summary of Sequence Search
    1::294
    3::236     3e-15  36%  244 aa  PF00696 AA_kinase "Amino acid kinase family"
    1::294

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxIVVKYGGHAMGDSTLGKAFAEDIALLKQSGINPIVVHGGGPQI
PF00696         ---------------------------IVVKFGGSSLADAELRRV-ADDIAELHELGVRVVVVSGGGPQT


                         .         .         *         .         .         .         .:140
query           GAMLSKMGIESKFEGGLRVTDAKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAKKT
PF00696         NLLLLALGI-APGGAGLRVTDGAAGLVLERAAAAELNQPLVSLGERLSAPAVAALLKDAGVNARERD---


                         +         .         .         .         .         *         .:210
query           VIDPDSNIERVLDLGFVGEVVEVDRTLLDLLAKSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALHAT
PF00696         --------ARELGVGSPGVIEEVDREAIRELLDAGRVPIVTGFGGENDTGEITTGSDTTAALLAAALGAD


                         .         .         .         +         .         .         .:280
query           RLLFLTDVPGVLDKNKELIKELTVSEARALIKDGTISGGMIPKVETCIDAIKAGxxxxxxxxxxxxxxxx
PF00696         ELIILTDVDGVYTPDAKLIPELSYDEAAEL-----ATGGMKVKHPAAIEAARRG----------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxx
PF00696         --------------