[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK86297.2

[Show Plain Result]


## Summary of Sequence Search
    1::216
    2::54      7e-11  55%   57 aa  PF00196 GerE "Bacterial regulatory proteins, luxR family"
    1::111     8e-07  29%  111 aa  PF00072 Response_reg "Response regulator receiver domain"
    1::216

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxIIIADDHPLFRGALKQAVAGLDGQQTIIEAGDFEAARHAATTRNXXXXXXXXXXXPGVSGFSGLM
PF00196         ----------------------------------------------------------------------
PF00072         -----ILIVDDDPVNRELLKRLLEKLGYVVTTAEDGE-EALELLEEHR--PDLVLLDINMPGMDGLELLR


                         .         .         *         .         .         .         .:140
query           ALRAEFSSLPIVIVSATDDATTVRRSIELGASGFISKSSGIDDIRDGIRxxxxxxxxxxxxxxxxxxxxx
PF00196         ----------------------------------------------------------------------
PF00072         RIRELEPDIPIIVLTAYDDEEDAVRALEAGADDYLTKPFDPEELLAAIR---------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxTLTPQQSRVLGMLAEGLLNKQIAYELNVSEATIKAHVSAILLKLKVDSRTQAVxxxxxxx
PF00196         ----------SLTPREREVLRLLAEGLSNKEIAERLGISEKTVKTHRSNILRKLGVRNRTELV-------
PF00072         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxx
PF00196         ------
PF00072         ------