[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK86335.1

[Show Plain Result]


## Summary of Sequence Search
    1::181
    1::99      3e-25  55%  112 aa  PF03975 CheD "CheD"
    1::181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLLPGTGNVTGGDATRYGVH
PF03975         ---------------------------------------------------MLPDSGKSKASNPARYGDY


                         .         .         *         .         .         .         .:140
query           LMELLINGLLKQGARRDRLEAKVFGGAKTIASFSNVGEQNAIFAMQFLKDEGIPVISSSTGGDHGRKIEF
PF03975         AMELLINELLKLGARRERLEAKVFGGAQMFAGSTNIGERNAEFVREYLAKEGIPIVAEDLGGNHGRKVEF


                         +         .         .         .         .         *         .:210
query           WPVSGRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03975         DPDTGR-----------------------------------