[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK86457.1

[Show Plain Result]


## Summary of Sequence Search
    1::418
    6::271     4e-71  52%  271 aa  PF02353 CMAS "Cyclopropane-fatty-acyl-phospholipid synthase"
   17::91      1e-07  40%  154 aa  PF05175 MTS "Methyltransferase small domain"
    1::74      4e-07  38%   96 aa  PF08241 Methyltransf_11 "Methyltransferase domain"
    1::96      8e-06  32%  156 aa  PF03848 TehB "Tellurite resistance protein TehB"
   87::242     1e-04  34%  243 aa  PF08704 GCD14 "tRNA methyltransferase complex GCD14 subunit"
    1::87      4e-04  31%  100 aa  PF08242 Methyltransf_12 "Methyltransferase domain"
  104::208     5e-04  28%  303 aa  PF08003 Methyltransf_9 "Protein of unknown function (DUF1698)"
    1::418

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02353         ----------------------------------------------------------------------
PF05175         ----------------------------------------------------------------------
PF08241         ----------------------------------------------------------------------
PF03848         ----------------------------------------------------------------------
PF08704         ----------------------------------------------------------------------
PF08242         ----------------------------------------------------------------------
PF08003         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKSNVAHHYDLSAKLFDLFLDEDWQ
PF02353         ----------------------------------------------RENIQAHYDLGNDFYALFLDPTMT
PF05175         ----------------------------------------------------------------------
PF08241         ----------------------------------------------------------------------
PF03848         ----------------------------------------------------------------------
PF08704         ----------------------------------------------------------------------
PF08242         ----------------------------------------------------------------------
PF08003         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YSCAYFNPPDIGLYEAQVAKKRHIAAKLMTEPGQSVLEIGSGWGGMAMYIAESAGADVTGITLSEEQLRV
PF02353         YSCAYFEDPDETLEEAQEAKLDLILEKLGLKPGMRVLDIGCGWGGLALYAAERYGVKVTGVTLSEEQAAY
PF05175         -------------------------------PGGRVLDLGTGSGAIALALAELPDAEVTAVDISPDALEL
PF08241         ------------------------------------LDLGCGTGRLARALARRGGR-VTGVDISPEMLEL
PF03848         --------------EELVSLIKKLEAVKLVKPGK-VLDLGCGEGRNALYLA-AQGFDVTAVDKSEEAIEK
PF08704         ----------------------YILHRLDIRPGSRVLEAGTGSGSLTHALARAVGP--TGKVYS------
PF08242         ------------------------------------LDIGCGTGNLLIPLLEAPGAEYTGIDISPAALEA
PF08003         --------------------------------GRTVLDVGCG-SGYHMWRMLGAGAKLV-VGIDPSQLFL


                         .         .         .         +         .         .         .:280
query           SRDRAAKRGLAGNVRFELQDYRYLPASKKYDRIVSVGMFEHVGPTHYRDYFDKVAEVLDDKGVMVLHSIG
PF02353         AQERIAEAGLSDRVEVLLQDYRDLPG--PFDRIVSIEMFEHVGHKNYPTYFKKVHRLLKPGGLLLLHTIT
PF05175         ARRNAARNGLENRVEFIQGDFEPLPGG-RFDLIVS-----------------------------------
PF08241         ARERAAEAGLEN--RFVVGDAEDLPPDGSFDLVLSSHVLEHL----------------------------
PF03848         LKRIAEKEGL--DIHTIVVDLNNLSLDEEYDFILSTVVLMFLPP--------------------------
PF08704         ---------------FEFHEQR---AEKAREEFEEHGLDDNVTVTHRDVCNDGFGEGLEGSADAVFLDLP
PF08242         ARERFAR---LGPLNFERLDFEQLDIE---DLDLEAGSFDLVVASNVLHHLEDLKAVL------------
PF08003         CQFEAVRKLLGNDQRAHLLGIEQLPALEAFDTVFSMGVLYH--RRSPLDHLDQLKDQLVKGGELVLETL-


                         .         *         .         .         .         .         +:350
query           QPYPALATNPFIEKYIFPGGYIPSLAEVLPAIQKSGLLVKDIEILPMHYAHTLRHWRERFVARKAEAVAL
PF02353         IPDERYETGDFINKYIFPGGYLPSLSEILEAAEEAGLEVEDVENLGPHYARTLRAWRENFEANWDEARAL
PF05175         ----------------------------------------------------------------------
PF08241         ----------------------------------------------------------------------
PF03848         ----------------------------------------------------------------------
PF08704         APWLAL---PHAVKALKPGGRIPCIEQVVEALREHGFTIETVEVL-------LREWRERVLVR-------
PF08242         ----------------------------------------------------------------------
PF08003         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           YDERFFRMWEFYLAGSEMAFTHENFHIFQIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02353         YDERFYRMWRYYLAYCAAGFRAGNIDVHQL--------------------------------------
PF05175         --------------------------------------------------------------------
PF08241         --------------------------------------------------------------------
PF03848         --------------------------------------------------------------------
PF08704         --------------------------------------------------------------------
PF08242         --------------------------------------------------------------------
PF08003         --------------------------------------------------------------------