[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK86566.1

[Show Plain Result]


## Summary of Sequence Search
    1::272
   12::169     5e-08  28%  169 aa  PF00106 adh_short "short chain dehydrogenase"
   45::201     3e-05  30%  237 aa  PF12241 Enoyl_reductase "Trans-2-enoyl-CoA reductase catalytic
    1::272

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxIAWGIAKACADAGAELALTWQGDALKKRVEPLAQELGAFMAGHCDVT
PF00106         -----------------------IGRAIARALAAEGAKVVVLTARNA--EALEELAAELGRVIAVQLDVT
PF12241         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DLETIDSVFASLEQHWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFNRTMDISVFSLAAVAKRAEPIMND
PF00106         DEASVEALVEEVVEEFGRLDILVNNAGIAGDGPLE----DLTEEDFDRVFDVNLLGPFLLTQAALPLMRG
PF12241         -----------IKEDLGQVDLVVYSLASPRRTDVTGKTLDTDKDNTVKVMGGEDWELWIDALAEAGVLAE


                         +         .         .         .         .         *         .:210
query           GGSIITLTYYGAEKVMPNYNVMGVAKAALEASVRYLAVDLGNRGIRVNAVSAGPIKTLAASGIxxxxxxx
PF00106         GGRIVNISSVAGLLGSPGQAAYAASKAALNGLTRSLAAEAG-----------------------------
PF12241         GAKTVAYSYIGPELTWPIYGTIGAAKADLEATARAINEKLAALGGRANVSVLKALVTQASSAI-------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00106         --------------------------------------------------------------
PF12241         --------------------------------------------------------------