[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK86654.1

[Show Plain Result]


## Summary of Sequence Search
    1::140
    1::99      1e-09  40%   99 aa  PF02566 OsmC "OsmC-like protein"
    1::140

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGDGARGTNPEQLFAAGYSACFLGALKAVAGKHK
PF02566         -------------------------------------GGGGEGPNPEELLLAALAACFAMTLRLVAAKKG


                         .         .         *         .         .         .         .:140
query           VKIPEDTTVTATVGIGPREDGTGFGIEVTLKVNIPGLEREKAEELVAAAHIVCPYSHAMRTSTEVPVSxx
PF02566         IDL-EDVEVEVEGELDP-EGGRFTEIVLHVTVTVPGLDAEEAERLVERAHKKCPVSRSLRGPVEVTLS--