[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK86734.2

[Show Plain Result]


## Summary of Sequence Search
    1::435
   17::299     1e-13  33%  324 aa  PF00144 Beta-lactamase "Beta-lactamase"
    1::435

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00144         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVVLHKGVLVYERYSGCLN
PF00144         ---------------------------------------------------VLVVKDGKVVYEKAFGYAD


                         +         .         .         .         .         *         .:210
query           EAGQHGAMSVTKSLTGLLGEMLVAEGTLDENAKVATVVPELEKSAFGDATIRQVLDMTTGLRYSEDYADP
PF00144         ETGRFRIASVTKSFTAAAVLQLVEEGKLDLDDPVSKYLPELAGPGKDGITLRQLLTHTSGL---PDYFAP


                         .         .         .         +         .         .         .:280
query           NADVWIYSAAGNPLPKPDGYEGPRSYFDYLKTVVKQGENGSAFGYKTINSDALGWVIARASGKSVAELLS
PF00144         --DDLLDDAAD---------WGPEELLRRLAALPLLFEPGTRFSYSNTGYGLLGLIIERVTGKSLEEYLE


                         .         *         .         .         .         .         +:350
query           QRIWSRIGAEQDAYYTVDSTGTPFAGGGLNAGLRDMARIGQLLLDDGMAGGHRLIPQKAIDNIRHGGDKA
PF00144         ERIFEPLGMTDTTFYTRNGDGEAYSGGGLFSTARDLAKFLGLALNGG-----KLLSEETLAQLT---TWL


                         .         .         .         .         *         .         .:420
query           AFAKGGYPALRGWSYRAMWWVTHNANGAFMARGVHGQAIYVDPxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00144         LTGPTGTPGIRA-GYGLGWFVADKTGGAFGHTGGYGTFLWIDP---------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxx
PF00144         ---------------