[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK86736.1

[Show Plain Result]


## Summary of Sequence Search
    1::757
   17::178     2e-42  51%  178 aa  PF00912 Transgly "Transglycosylase"
    3::272     1e-38  45%  289 aa  PF00905 Transpeptidase "Penicillin binding protein transpeptidase
    1::757

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00912         ----------------------------------------------------------------------
PF00905         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00912         ----------------------------------------------------------------------
PF00905         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxVPIDQMPDHFIKAVLATEDRRFFDHFGIDFIGLARAMSENARAGGVVQGGSTLTQQLAKNLFLTN
PF00912         -----VPLDEIPPNLVNALLAIEDRRFYEHPGVDPKGIARAALSNLRSGGSVQGGSTITQQLAKNLFLSN
PF00905         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ERSLERKIKEAFLALWLESNMSKKEILSLYLDRAYMXXXXXXXXXXXXXXXXKNLTDVTLSESAILAGLF
PF00912         ERTLTRKLREAILALKLERLYSKDEILELYLNTVYFGNGAYGIEAAAQAYFGKDAKDLTLAEAALLAGLP
PF00905         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAPAKYAPHVNLPAARARANTVLSNLVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00912         KAPSYYNPYRNPERAKARRNVVLDRML-------------------------------------------
PF00905         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAMVMIENGGGVRAMVGGRDYGESQF
PF00912         ----------------------------------------------------------------------
PF00905         ---------------------------------------------AVVMDPKTGEVLAMVGGPDYDPNKF


                         .         .         +         .         .         .         .:490
query           NRATAALRQPGSSFKVYTYSAAMEKGMKPDTLISDAPVTWRGWSPQNYGRSYAGKVTLQVALAKSYNTVP
PF00912         ----------------------------------------------------------------------
PF00905         NRATQAVRQPGSTFKPFTYAAALEEGITPNTTIDDPPIPVGGYTPKNWDRGGHGPVTLREALAKSSNVYF


                         *         .         .         .         .         +         .:560
query           VRLAKDVLGTQVIVDTAKAMGVATPLRSDKTIPLGTSEVTVLDQATAYAVFPADGMQSRRHGIEQVMDYE
PF00912         ----------------------------------------------------------------------
PF00905         VRLALK-LGPDRLADYAKGLGVKTGIDLPGEVPQGSVSVTPLQLANAYATIANGGVRVKPHLVKKITDAD


                         .         .         .         *         .         .         .:630
query           GNVLYDFSHDEPPAKRVLSEEANSKMNQMLVTIPVMGTARRGALDNGIVSGGKTGTSQAYRDAWYVGFTG
PF00912         ----------------------------------------------------------------------
PF00905         GNVV----EKEPPGKRVISPETAYLVREMMRGVVTGGTTGRAAKVPGYPVAGKTGTAQGNYDAWFVGFNP


                         .         +         .         .         .         .         *:700
query           NYTTAVWFGNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00912         ----------------------------------------------------------------------
PF00905         KIAVAVWVGN------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00912         ---------------------------------------------------------
PF00905         ---------------------------------------------------------