[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK86987.1

[Show Plain Result]


## Summary of Sequence Search
    1::863
    6::394     7e-79  44%  394 aa  PF00940 RNA_pol "DNA-dependent RNA polymerase"
    1::863

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00940         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00940         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00940         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00940         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00940         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00940         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxEEGADWLAIHGAGLWGVDKCSMNERVEWVMANQREILASAENP
PF00940         ---------------------------ESGLRWLKIHLANLYGFDKASFDERVQFVEDNLEDILDSAENP


                         *         .         .         .         .         +         .:560
query           YDNRFWLTAEKPWQALAFCFEWQGYVAEGFAFHSHLPVQMDGTCNGLQNFSAMLLDEIGGAAVNLVPSDK
PF00940         LDGRWWLKADDPWQFLAACIELANALDSGTKYVSHLPVHQDGSCNGLQHYAALGRDEIGAKQVNLIPSDR


                         .         .         .         *         .         .         .:630
query           PNDIYATVASVLIAKLRDIAAACPXXXXXXXXXXXXXXXXXXIVVESDGSMARKWLAYGITRKVTKRPVM
PF00940         PQDVYSGVAELVKERIEKDA--------------------------EKGNELAKLLEGKITRKVVKQTVM


                         .         +         .         .         .         .         *:700
query           TLAYGASEFGFREQVFTDTVTPWKQAAGEAFPFEGTGFAAASFLGLLIWDCXXXXXXXXXXXMDWLQKVA
PF00940         TNVYGVTFIGARDQIKKQLKDLYDDPADEE-----ELNAAASYLAKKIFEALGEMFPGAHEIMDWLGECA


                         .         .         .         .         +         .         .:770
query           KIAAKESLPVIWNTPAGLKVMQEYTTSEQKRLELTFQKVRLQLSIDVASKKIDKRKQGSGISPNWVHSMD
PF00940         KRISKSNSPVIWTTPLGLPVVQPYRKSKKKRVKTSLQSLSLRDPND--TDPVDKRKQRQAFPPNFIHSLD


                         .         .         *         .         .         .         .:840
query           AAHMQLTVSRCHDEGIRSFSLIHDSYGTHAGNAWAMAQFLREEFVKMYGDHDVLAEFGREITAMLPEGTQ
PF00940         ASHMMLTALKCDEAGL-SFAAVHDSFWTHACDVDKMNRILREAFVELYSE-DILERLAEEFKARYPNSLY


                         +         .         .         .         .         *         .:910
query           LPPLPEKGSLDLSQVLESAFFFx
PF00940         LPPLPEKGDLDLEEVLKSPYFF-