[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK87067.1

[Show Plain Result]


## Summary of Sequence Search
    1::396
    1::254     3e-92  63%  254 aa  PF00346 Complex1_49kDa "Respiratory-chain NADH dehydrogenase, 49 Kd
    1::396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00346         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDVGAMTPPVWGFEEREKLM
PF00346         ---------------------------------------------------EVGAMTPFLYAFREREKIL


                         +         .         .         .         .         *         .:210
query           VFYERACGARMHSAYVRPGGVHQDLPPELVDDIGKWCDPFLTVLDNIEGLLTDNRIYKQRNVDIGVVSLE
PF00346         DLFEAITGARMHAAYIRPGGVARDLPDGWLDKIRDFLDYFPKRLDEYEDLLTDNRIFKQRTVGVGVLSAE


                         .         .         .         +         .         .         .:280
query           DAFAWGFTGVMVRGSGAAWDLRRSQPYECYSDLEFDIPVGKNGDCYDRYLIRMQEMRESVKIMKQCVDRL
PF00346         DALALGLTGPMLRASGVPWDLRKDQPYAGYDELDFDVPVGKNGDCYDRYLVRMEEMRQSLRIIEQCLDKL


                         .         *         .         .         .         .         +:350
query           SGKHRIGPVSSLDGKVVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYVVADGSN
PF00346         PE----GPVMVEDPKIAP----EMK-------------TEGFKVPAGEVYVAVEAPKGELGVYLVSDGSN


                         .         .         .         .         *         .         .:420
query           KPYRCKIRAPGYAHLQAMDFLCKGHQLADVTAVLGSLDIVFGEVDR
PF00346         KPYRVKIRAPSFANLQALPEMLRGHMLADVVAIIGSIDIVMGEVDR