[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK87170.1

[Show Plain Result]


## Summary of Sequence Search
    1::247
    1::221     7e-65  53%  222 aa  PF01255 Prenyltransf "Putative undecaprenyl diphosphate synthase"
    1::247

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxIMDGNGRWAKQRGLPRVMGHRRGVEAVRETVRAAGDCGISYLTLFAFSSENWRRP
PF01255         ---------------IMDGNRRWAKKRGLPRVEGHRAGFEALARILEWCYELGVKVVTVYAFSTENFKRP


                         .         .         *         .         .         .         .:140
query           ESEVSDLMGLLKAFIRRDLAELHRENVRVRIIGDRQGLKTDIRSLLEEAEQMTAGNTKLTLVIAFNYGSR
PF01255         KEEVDALMDLAEEKLEQLAQELDDYGIRVRVIGDLDLLPPDVREAIERAEELTANNTGLVLNIAVNYGSR


                         +         .         .         .         .         *         .:210
query           DEITRATASIARDVAEGRLSADAITPEMISSRLDTSGMPDPDLIIRTSGEERLSNFLLWQAAYSEFLFVP
PF01255         DEITDAVRKLAEEVAAGKLSPEDITEETLEKHLYTAGLPDPDLLIRTSGEQRLSNFLLWQIAYSELYFLD


                         .         .         .         +         .         .         .:280
query           EYWPDFDRQRFFSAIEQYATRDRRFGxxxxxxxxxxx
PF01255         VLWPDFDLWDFLRALLDYQRRERRFG-----------