[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK87211.2

[Show Plain Result]


## Summary of Sequence Search
    1::306
   57::223     5e-08  30%  284 aa  PF02219 MTHFR "Methylenetetrahydrofolate reductase"
  101::165     1e-04  42%  504 aa  PF01019 G_glu_transpept "Gamma-glutamyltranspeptidase"
    1::306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPIADMVSTAKR
PF02219         ----------------------------------------------------------------LEAAAR
PF01019         -----------------------------------------------------------PWADLLAPAIR


                         .         .         *         .         .         .         .:140
query           LHDEGFPVMPHLPARGISGKNELEDWLKRYQGEAGVTQALLLGGGQKQPAGSFSSSIDMIETGLFDKMGF
PF02219         IQKEGLEPVPHLTCRD-RNREELQSILLGAKA-LGIRNILALRGDPPKPVGDFRYALDLVRLIREEYGDY
PF01019         LAEEGFPVSPRL-ARALASA---ADRLARDPGSA----AIFLPDGRPPKAGDILRNPDLART--------


                         +         .         .         .         .         *         .:210
query           THLHLAGHPEGNRDIDSDGSSRGVDQALLWKQDFASRTDARLALTTQFAFEAKVVIEWAKRIGNMGVTIP
PF02219         FDIGVAGYPEGHPEADLERLKRKVDAG----ADF---------IITQLFFDAEAYLRFVDRCRAAGIDVP
PF01019         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VHVGIAGPTKLQTLIKFAIACGVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02219         IIPGIMPITSYKQLRRFAKLCGV-----------------------------------------------
PF01019         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
PF02219         --------------------------
PF01019         --------------------------