[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK87429.2

[Show Plain Result]


## Summary of Sequence Search
    1::228
    1::156     1e-12  34%  157 aa  PF00881 Nitroreductase "Nitroreductase family"
    1::228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxIETRRDVRDQFLPDPLPEELVERLLKAAHSAPSVGFMQPWNFT
PF00881         ---------------------------LKSRRSVR-KFDPEPVSDEELEEILEAARLAPSSGNLQPWRFV


                         .         .         *         .         .         .         .:140
query           LVTDGGVRQAAWVAFSRANEEAAAMFEGEKQALYRSLKLEGIRKAPLSICVTCDPTRGGKVVLGRTHNPR
PF00881         VVRDPELKER--LAPAALELLAAAEADAE------TGNQENLFDAPVVLVVV-----GKKDYYTNAYGER


                         +         .         .         .         .         *         .:210
query           TDVYSTVCAIQNLWLAARAEGIGVGWVSIFHDSDVRAILDIPEHIEIVAWLCLGxxxxxxxxxxxxxxxx
PF00881         GYRWAQLIAAQNLLLAATALGLGSCPIGGFDTDAVRELLGLPENETPLALIAVG----------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxx
PF00881         ------------------