[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK87597.2

[Show Plain Result]


## Summary of Sequence Search
    1::417
    2::264     1e-25  34%  279 aa  PF00579 tRNA-synt_1b "tRNA synthetases class I (W and Y)"
    5::46      0.001  40%   46 aa  PF01479 S4 "S4 domain"
    1::417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKETVTAYIGYDPTASSLHVGHLTQIMMLHWMQKTGHQP
PF00579         --------------------------------EKPLRVYTGIDPTGD-LHLGYLGPLRKLVRLQDAGHDV
PF01479         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ISLMGGGTGMVGDPSFKEEARKLMTIDMIEDNITSLKHVFANYLDYDRAENPALMINNADWLRGLNYLEF
PF00579         IILIADLHALIGDPS---DPRKLRT---------NTREVANAQLACGLDPEKTTIFNQSDWPEHLELAWF
PF01479         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LRDVGRHFSVNRMLSFDSVKTRLDREQSLSFLEFNYMILQAYDFVELNQRTGCRLQMGGSDQWGNIINGI
PF00579         LRCVTKHGTLNRMLQFKDVKKRLESGDGISLGEFSYPLLQAADILLLK----ADLVPGGSDQKQNIELGR
PF01479         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DLGHRMGTPQLYALTSPLLTTXXXXXXXXXXXXXVWLNKDLLPVYDFWQYWRNTEDADVVRFAKLFTTLP
PF00579         DLARRFNFPKPEALTTPLLPGLDGTKMSKSDGNAIFLDDDPESIKKKIKKAKTDPDREVRRYLK--GRPE
PF01479         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           MDEIARIATLGGSEINEAKKILATEVTAILHGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00579         LSNLIEILEAFGGDDPEAEELLAEYVTGLLHG--------------------------------------
PF01479         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxLIVRAGLASSNGEARRHVQGGAVKINEQGVSDERQIIGTGEVxxxxxxxxxxxxxxxxxxxxx
PF00579         -------------------------------------------------------------------
PF01479         ----LLARLGLASSRSEARQLIEHGHVLVNGKVVTDPSYRVKPGDV---------------------