[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK87761.1

[Show Plain Result]


## Summary of Sequence Search
    1::200
    1::62      2e-05  48%   63 aa  PF00226 DnaJ "DnaJ domain"
    1::200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxDPYVLLGVERDADEAAIKTAYRKVAKAAHPDSGGDGEQFARLQTAYELLKDPVRRRVFxxxxxxxxxx
PF00226         --DYYEVLGVPRGASLEEIKKAYRKLALKYHPDKNGDEEKFKEINEAYEVLSDPEKRAAY----------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00226         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00226         ------------------------------------------------------------