[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK87844.1

[Show Plain Result]


## Summary of Sequence Search
    1::378
    1::130     1e-21  45%  138 aa  PF03033 Glyco_transf_28 "Glycosyltransferase family 28 N-terminal
    1::146     3e-20  36%  162 aa  PF04101 Glyco_tran_28_C "Glycosyltransferase family 28 C-terminal
    1::378

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxVLLAAGGTGGHVFPAEALAHTLKARGYQVHLVTDSRAERYAGKFPADEIHVVPSATIGSKNPISV
PF03033         -----ILIAAGGTGGHVFPALALAEALRARGHEVRLATPPGFEAFV---EAAGLEFVPMVGLRRKGSLAN
PF04101         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VRSLWKLWVGLRTARRLVTKLKPVAVVGFGGYPTVPPLLASTGLGVPSIIHEQNAVMGRANKALxxxxxx
PF03033         LKDPFRLLKGVRQARRILRRFKPDVVVGTGGYVSAPAVIAAPLLGIPVVIHEQNGIPGLANKLL------
PF04101         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQLVVFGGSQGAQFFSSAVPAAICLM
PF03033         ----------------------------------------------------------------------
PF04101         ---------------------------------------------RILVTGGSQGARSLNEAVLEALFLL


                         .         .         .         +         .         .         .:280
query           KDEQRKRIVVTQQARPEDKDSVIASYQKLGVKADVSPFFGDMASRIGEADLVISRSGASTVSELSVIGRP
PF03033         ----------------------------------------------------------------------
PF04101         ---LLKDLQVIHQTGKNDLEEVKLAYAKLGINVKVFPFIDDMAELMAAADLVISRAGAGTIAEALALGKP


                         .         *         .         .         .         .         +:350
query           SILVPYPXXXXXXXXXXXXXXXXXXXXXVIKQAELSPQKXXXXXXXXXXEPDRLxxxxxxxxxxxxxxxx
PF03033         ----------------------------------------------------------------------
PF04101         AILVPNPGAADDHQDNNALELAKAGAALVILQADLTPEDLAEALRELLEDPERL----------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03033         ----------------------------
PF04101         ----------------------------