[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK87903.2

[Show Plain Result]


## Summary of Sequence Search
    1::415
    1::322     3e-70  49%  338 aa  PF07221 GlcNAc_2-epim "N-acylglucosamine 2-epimerase (GlcNAc
    1::415

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGFFDLDAKGAPLQANDPVRGIHASARMVH
PF07221         -----------------------------------------GFFGLDRDGQPLDTAR--KRLWLQARQLW


                         .         .         *         .         .         .         .:140
query           CFSIGHLLGRPGCGDIVDHGMTYLWNNHRDGEHGGYFWQVNDAGPVDATKQGYGHAFVLLAASSAKTVGH
PF07221         VFSLAYRLGRPGYLELAEHGLDFLRDHFRDPEHGGWYWSLDDGGPLDDTKDLYGHAFALLALAEARATGD


                         +         .         .         .         .         *         .:210
query           PLADQMLADITEVLETRFWEEKHGAIAEEFNRDWSPIDNYRGQNSNMHLTEALMAAYEATGDSNYLTKAE
PF07221         PEALELAEETFELIEKRFWDPEGGLYREEFDRDWSPLE-YRGQNPNMHLLEAYLALYEATGDPRWLDRAE


                         .         .         .         +         .         .         .:280
query           RIADLVIRRRAGELDFRVPEHFDENWTLDKAYRGNEMFRPSGSTPGHWLEWARLILQLWVLGERQHDWMP
PF07221         RLADLILDRFADPNDGRVPEHFDADWNPDPDYNGD----PRGFTPGHQIEWAWLLLEL-AAGLGDPDWLE


                         .         *         .         .         .         .         +:350
query           VAAKSLFVQSMALGWDREKGGFFYTLDWNDNPDKRAKLWWPMCEAAGAAHFLNENLPADAFYEDSYRRIW
PF07221         -RAKRLFDAALEDGWDPDGGGLVYTLDWDGKPVDRDKLWWVQAEALAAALALYQ-LTGDERYLDWARRIW


                         .         .         .         .         *         .         .:420
query           STIANNFIDHENGGWHEELTEDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07221         DYIWRHFIDHEYGEWFGELDAD-------------------------------------------