[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK87977.1

[Show Plain Result]


## Summary of Sequence Search
    1::155
    5::101     1e-08  42%  116 aa  PF01575 MaoC_dehydratas "MaoC like domain"
    1::155

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxERVTLDTLHFSAEDIIRFARDFDPQPFHLDAEAARNSVFGGLCASGWHTGAGWMKSFLSH
PF01575         ----------ELLAADPRTVTEEDIRLFAGSGDYNPIHLDPEAAKAAGFGGLIAHGMLTAAGLLVDWL--


                         .         .         *         .         .         .         .:140
query           WAKEVKRLKLQGLEPPKLGPSPGFRELKWKKPVFAGDDVTYFVTLLDARxxxxxxxxxxxxxxxxxxxxx
PF01575         --------------PGGAGANYGSQEVRFLKPVFPGDTLTVEVTVTGKR---------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxx
PF01575         ---------------