[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK87989.1

[Show Plain Result]


## Summary of Sequence Search
    1::303
    1::270     2e-61  49%  294 aa  PF01218 Coprogen_oxidas "Coproporphyrinogen III oxidase"
    1::303

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxAVAQAWFQHLRDTIVASFETLEDELTGPLSDQEPGRFVQKDWLRDNXXXXXX
PF01218         ------------------ARVEAWLKDLQDRICAALEALDGA----------AKFKEDAWTRPEGGGGRS


                         .         .         *         .         .         .         .:140
query           XXXXXXXRVFEKVGVHTSTVYGEFSPEFRKQIPGAEEDPRFWASGLSLIAHPVNPNVPAVHMNTRMVVTT
PF01218         RVLQDG-RVFEKAGVNFSVVHGELLPAAATAMRPELAGRPFFATGLSLVIHPRNPYVPTVHMNYRYFITP


                         +         .         .         .         .         *         .:210
query           SHWFGGGADLTPVLGRRRTQQDPDTQLFHRAFEITCNRHPIADYPRYKSWCDEYFFLKHRDEPRGTGGIF
PF01218         VWWFGGGADLTPYY-----LFEEDAVHFHQTLKDACDPHGPEYYPRFKKWCDEYFYLPHRNEARGVGGIF


                         .         .         .         +         .         .         .:280
query           FDWLHPDEEKGGWDANFTFVQDVGRAFNLVYPKIVRANFNQNWTEEDRDEQLIRRGRYVEFNLLYDRGTI
PF01218         FD----DLNSGDFEADFAFVQDVGDAFLPAYLPIVERRKDTPYTEREREWQLYRRGRYVEFNLVYDRGTK


                         .         *         .         .         .         .         +:350
query           FGLKTGGNVESILSSLPPVVRWx
PF01218         FGLQTGGRTESILMSLPPLARW-